Jump to content

Welcome to Geeks to Go - Register now for FREE

Geeks To Go is a helpful hub, where thousands of volunteer geeks quickly serve friendly answers and support. Check out the forums and get free advice from the experts. Register now to gain access to all of our features, it's FREE and only takes one minute. Once registered and logged in, you will be able to create topics, post replies to existing threads, give reputation to your fellow members, get your own private messenger, post status updates, manage your profile and so much more.

Create Account How it Works

Remnants after infection? [Solved]

  • This topic is locked This topic is locked




  • Topic Starter
  • Member
  • PipPipPip
  • 343 posts
Okay, I can't say I wasn't expecting this to happen sooner or later, being a shared PC and all.

When I first built this machine, I had a friend who runs his own computer company come and install Windows 7 and do the initial setup. These types of businesses order operating systems in bulk, so he gave us one of his unsold product keys. So, while snagging the aforementioned key from the registry is relatively simple, I do not have access to a Windows 7 Install Disk.

Because of this, I am going to ask his opinion on this matter, and get a second opinion on the best course of action. As far as I know, there is no compromising information present on this machine, so I am not too worried about this potential breach. In the meantime, if there is anything in those logs, let's get rid of it. We'll see where to go from there.
  • 0




    Anti-Malware Mammoth

  • Expert
  • 9,717 posts
Hi. :)

I advice you read this tutorial of mine and create a Windows 7 SR disk if you have not done so...As this may prove to be of use in the event of something unforeseen.

if there is anything in those logs, let's get rid of it. We'll see where to go from there.

Fair play, lets proceed as follows...

Note: If you have any problems downloading any of the below as you did with OTL, merely temp' disable Symantec Endpoint for the duration then re-enable again afterwards. How to do so can be read here.


  • Please download CKScanner from here to your Desktop.
Make sure that CKScanner.exe is on the your Desktop before running the application!
  • Right-click on CKScanner.exe and select Run as Administrator then click Search For Files. <-- Only run the scan once.
  • After a very short time, when the cursor hourglass disappears, click Save List To File.
  • A message box will verify the file saved
  • Double-click on the CKFiles.txt icon on your Desktop and copy/paste the contents in your next reply.

  • Please download this tool from Microsoft.
  • Right-click on MGADiag.exe and select Run as Administrator to run it.
  • Click Continue.
  • The program will run. It takes a while to finish the diagnosis, please be patient.
  • Once done, click on Copy.
  • Open Notepad and paste the contents in. Save this file and post it in your next reply.
Scan with WVCheck:

Please download WVCheck and save it to the desktop.

  • Right-click on WVCheck.exe and select Run as Administrator, follow the prompts.
  • The scan may take some time depending on the Hard-Drive size.
  • Please post the contents of the notepad file WVCheck_nnnn_dd-mm-yyyy that can be located on the desktop.
When completed the above, please post back the following in the order asked for:

  • How is your computer performing now, any further symptoms and or problems encountered?
  • CKScanner Log.
  • MGADiag Log.
  • WVCheck Log.

  • 0




  • Topic Starter
  • Member
  • PipPipPip
  • 343 posts
My PC is performing fine - apart from the possibility of the trojan breach of course. :)

CKScanner log

CKScanner - Additional Security Risks - These are not necessarily bad
c:\program files\comicrack\changes.txt
c:\program files\comicrack\comicrack.engine.display.forms.dll
c:\program files\comicrack\comicrack.engine.dll
c:\program files\comicrack\comicrack.exe
c:\program files\comicrack\comicrack.exe.config
c:\program files\comicrack\comicrack.ini
c:\program files\comicrack\comicrack.plugins.dll
c:\program files\comicrack\comicrack.url
c:\program files\comicrack\cyo.common.dll
c:\program files\comicrack\cyo.common.presentation.dll
c:\program files\comicrack\cyo.common.windows.dll
c:\program files\comicrack\defaultlists.txt
c:\program files\comicrack\icsharpcode.sharpziplib.dll
c:\program files\comicrack\ironpython.dll
c:\program files\comicrack\ironpython.modules.dll
c:\program files\comicrack\license.txt
c:\program files\comicrack\microsoft.dynamic.dll
c:\program files\comicrack\microsoft.scripting.dll
c:\program files\comicrack\microsoft.scripting.metadata.dll
c:\program files\comicrack\microsoft.windowsapicodepack.dll
c:\program files\comicrack\microsoft.windowsapicodepack.shell.dll
c:\program files\comicrack\newstemplate.html
c:\program files\comicrack\readme.txt
c:\program files\comicrack\sharppdf.dll
c:\program files\comicrack\tao.opengl.dll
c:\program files\comicrack\tao.platform.windows.dll
c:\program files\comicrack\uninst.exe
c:\program files\comicrack\windows7.multitouch.dll
c:\program files\comicrack\help\comicrack online manual.ini
c:\program files\comicrack\help\comicrack wiki.ini
c:\program files\comicrack\help\readme.txt
c:\program files\comicrack\resources\7z.dll
c:\program files\comicrack\resources\7z.exe
c:\program files\comicrack\resources\7z64.dll
c:\program files\comicrack\resources\c44.exe
c:\program files\comicrack\resources\ddjvu.exe
c:\program files\comicrack\resources\djvm.exe
c:\program files\comicrack\resources\libdjvulibre.dll
c:\program files\comicrack\resources\libjpeg.dll
c:\program files\comicrack\resources\libtiff.dll
c:\program files\comicrack\resources\libz.dll
c:\program files\comicrack\resources\icons\ageratings.zip
c:\program files\comicrack\resources\icons\ageratings_australia.zip
c:\program files\comicrack\resources\icons\formats.zip
c:\program files\comicrack\resources\icons\publishers.zip
c:\program files\comicrack\resources\icons\special.zip
c:\program files\comicrack\scripts\autonumber.py
c:\program files\comicrack\scripts\commitproposed.py
c:\program files\comicrack\scripts\newcomics.py
c:\program files\comicrack\scripts\otherscripts.py
c:\program files\comicrack\scripts\package.ini
c:\program files\comicrack\scripts\sample.py
c:\program files\comicrack\scripts\sample.xml
c:\program files\comicrack\scripts\searchandreplace.py
c:\program files (x86)\jdownloader\jd\plugins\hoster\crackedcom.class
c:\users\michal\downloads\american mcgee's alice pc [resourcerg games by klown]\american mcgee's alice\crack & serial\alice.exe
c:\users\michal\downloads\american mcgee's alice pc [resourcerg games by klown]\american mcgee's alice\crack & serial\serial.txt
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrack.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackalphatest.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackalphatestlightmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackalphatestlightmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackalphatestlightmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackalphatestlightmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackalphatestpointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackalphatestpointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackalphatestshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackalphatesttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmapalphatest.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmapalphatestlightmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmapalphatestlightmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmapalphatestlightmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmapalphatestlightmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmapalphatestpointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmapalphatestpointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmapalphatestshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmapalphatesttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmaplightmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmaplightmappointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmaplightmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmaplightmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmaplightmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmappointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackenvmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcracklightmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcracklightmappointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcracklightmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcracklightmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcracklightmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrack.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackalphatest.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackalphatestlightmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackalphatestpointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackalphatestpointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackalphatestshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackalphatesttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatest.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestlightmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestlightmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestlightmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestlightmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestpointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestpointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatestshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmapalphatesttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmaplightmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmaplightmappointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmaplightmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmaplightmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmaplightmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmappointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackenvmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncracklightmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncracklightmappointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncracklightmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncracklightmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncracklightmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetail.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestlightmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestpointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailalphatesttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmappointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetaillightmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailpointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackparallaxdetailtitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackpointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackpointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncrackshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackndetailncracktitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackpointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackpointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcrackshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetailcracktitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrack.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackalphatest.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackalphatestlightmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackalphatestlightmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackalphatestlightmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackalphatestlightmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackalphatestpointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackalphatestpointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackalphatestshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackalphatesttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcracklightmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcracklightmappointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcracklightmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcracklightmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcracklightmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrack.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackalphatest.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestlightmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestpointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestpointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackalphatestshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackalphatesttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncracklightmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncracklightmappointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncracklightmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncracklightmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncracklightmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetail.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatest.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestlightmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestpointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestpointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatestshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailalphatesttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmap.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmappointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmappointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmapshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetaillightmaptitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailpointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailpointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackparallaxdetailtitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackpointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackpointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncrackshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackndetailncracktitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackpointlight.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackpointlighttitaninterior.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcrackshadow.cfx
c:\users\widomski\documents\battlefield 2142\mods\bf2142\cache\{d7b71e3e-46ab-11cf-214c-99321fc2c535}_39_3\rashaderstmbasedetaildirtcracktitaninterior.cfx
scanner sequence 3.ZZ.11.MNNAFR
----- EOF -----

Windows Validation Data

Diagnostic Report (1.9.0027.0):
Windows Validation Data-->

Validation Code: 0
Cached Online Validation Code: N/A, hr = 0xc004f012
Windows Product Key: *****-*****-K96M7-34YXG-PPB67
Windows Product Key Hash: 609YSjlGJTgyzyOUJIRNsIzaIvU=
Windows Product ID: 00426-OEM-9402042-03822
Windows Product ID Type: 8
Windows License Type: COA SLP
Windows OS version: 6.1.7601.2.00010100.1.0.001
ID: {691CC77C-4052-4653-B9AE-4E35D6F6ABBF}(1)
Is Admin: Yes
TestCab: 0x0
LegitcheckControl ActiveX: N/A, hr = 0x80070002
Signed By: N/A, hr = 0x80070002
Product Name: Windows 7 Ultimate
Architecture: 0x00000009
Build lab: 7601.win7sp1_gdr.111118-2330
TTS Error:
Validation Diagnostic:
Resolution Status: N/A

Vista WgaER Data-->
ThreatID(s): N/A, hr = 0x80070002
Version: N/A, hr = 0x80070002

Windows XP Notifications Data-->
Cached Result: N/A, hr = 0x80070002
File Exists: No
Version: N/A, hr = 0x80070002
WgaTray.exe Signed By: N/A, hr = 0x80070002
WgaLogon.dll Signed By: N/A, hr = 0x80070002

OGA Notifications Data-->
Cached Result: N/A, hr = 0x80070002
Version: N/A, hr = 0x80070002
OGAExec.exe Signed By: N/A, hr = 0x80070002
OGAAddin.dll Signed By: N/A, hr = 0x80070002

OGA Data-->
Office Status: 100 Genuine
Microsoft Office Enterprise 2007 - 100 Genuine
OGA Version: N/A, 0x80070002
Signed By: N/A, hr = 0x80070002
Office Diagnostics: B4D0AA8B-604-645_025D1FF3-364-80041010_025D1FF3-229-80041010_025D1FF3-230-1_025D1FF3-517-80040154_025D1FF3-237-80040154_025D1FF3-238-2_025D1FF3-244-80070002_025D1FF3-258-3_E2AD56EA-765-d003_E2AD56EA-766-0_E2AD56EA-134-80004005

Browser Data-->
Proxy settings:
User Agent: Mozilla/4.0 (compatible; MSIE 8.0; Win32)
Default Browser: C:\Program Files (x86)\Mozilla Firefox\firefox.exe
Download signed ActiveX controls: Prompt
Download unsigned ActiveX controls: Disabled
Run ActiveX controls and plug-ins: Allowed
Initialize and script ActiveX controls not marked as safe: Disabled
Allow scripting of Internet Explorer Webbrowser control: Disabled
Active scripting: Allowed
Script ActiveX controls marked as safe for scripting: Allowed

File Scan Data-->

Other data-->
Office Details: <GenuineResults><MachineData><UGUID>{691CC77C-4052-4653-B9AE-4E35D6F6ABBF}</UGUID><Version>1.9.0027.0</Version><OS>6.1.7601.2.00010100.1.0.001</OS><Architecture>x64</Architecture><PKey>*****-*****-*****-*****-PPB67</PKey><PID>00426-OEM-9402042-03822</PID><PIDType>8</PIDType><SID>S-1-5-21-786879198-253778329-1393635891</SID><SYSTEM><Manufacturer>OEM</Manufacturer><Model>OEM</Model></SYSTEM><BIOS><Manufacturer>Phoenix Technologies, LTD</Manufacturer><Version>6.00 PG</Version><SMBIOSVersion major="2" minor="5"/><Date>20090522000000.000000+000</Date></BIOS><HWID>E2D73307018400FE</HWID><UserLCID>1009</UserLCID><SystemLCID>0409</SystemLCID><TimeZone>Mountain Standard Time(GMT-07:00)</TimeZone><iJoin>0</iJoin><SBID><stat>3</stat><msppid></msppid><name></name><model></model></SBID><OEM><OEMID>IntelR</OEMID><OEMTableID>AWRDACPI</OEMTableID></OEM><GANotification/></MachineData><Software><Office><Result>100</Result><Products><Product GUID="{90120000-0030-0000-0000-0000000FF1CE}"><LegitResult>100</LegitResult><Name>Microsoft Office Enterprise 2007</Name><Ver>12</Ver><Val>BFE1A04AF79FD86</Val><Hash>MfKyV7J/qfAwue2I1av5ikDxtDc=</Hash><Pid>89388-707-3322013-65460</Pid><PidType>14</PidType></Product></Products><Applications><App Id="15" Version="12" Result="100"/><App Id="16" Version="12" Result="100"/><App Id="18" Version="12" Result="100"/><App Id="19" Version="12" Result="100"/><App Id="1A" Version="12" Result="100"/><App Id="1B" Version="12" Result="100"/><App Id="44" Version="12" Result="100"/><App Id="A1" Version="12" Result="100"/><App Id="BA" Version="12" Result="100"/></Applications></Office></Software></GenuineResults>

Spsys.log Content: 0x80070002

Licensing Data-->
Software licensing service version: 6.1.7601.17514

Name: Windows® 7, Ultimate edition
Description: Windows Operating System - Windows® 7, OEM_COA_SLP channel
Activation ID: 022a1afb-b893-4190-92c3-8f69a49839fb
Application ID: 55c92734-d682-4d71-983e-d6ec3f16059f
Extended PID: 00426-00188-020-403822-02-4105-7601.0000-0902011
Installation ID: 011142986014908506719912054686077102025590039530569695
Processor Certificate URL: http://go.microsoft....k/?LinkID=88338
Machine Certificate URL: http://go.microsoft....k/?LinkID=88339
Use License URL: http://go.microsoft....k/?LinkID=88341
Product Key Certificate URL: http://go.microsoft....k/?LinkID=88340
Partial Product Key: PPB67
License Status: Licensed
Remaining Windows rearm count: 3
Trusted time: 23/04/2012 5:38:38 PM

Windows Activation Technologies-->
HrOffline: 0x00000000
HrOnline: N/A
HealthStatus: 0x0000000000000000
Event Time Stamp: N/A
ActiveX: Registered, Version: 7.1.7600.16395
Admin Service: Registered, Version: 7.1.7600.16395
HealthStatus Bitmask Output:

HWID Data-->

OEM Activation 1.0 Data-->

OEM Activation 2.0 Data-->
BIOS valid for OA 2.0: no, invalid SLIC table
Windows marker version: N/A
OEMID and OEMTableID Consistent: N/A
BIOS Information:
ACPI Table Name OEMID Value OEMTableID Value


Windows Validation Check
Log Created On: 1740_23-04-2012

Windows Information
Windows Version: Windows 7 Service Pack 1
Windows Mode: Normal
Systemroot Path: C:\Windows

WVCheck's Auto Update Check
Auto-Update Option: Download updates automatically, but ask me when I want to install them.
Last Success Time for Update Detection: 2012-04-23 17:43:35
Last Success Time for Update Download: 2012-03-14 19:00:09
Last Success Time for Update Installation: 2012-03-14 19:02:53

WVCheck's Registry Check Check
Antiwpa: Not Found
Chew7Hale: Not Found

WVCheck's File Dump
Size: 14336 bytes
Creation; 20/11/2010 20:23:48
Modification; 20/11/2010 20:23:48
MD5; 19f75d71e4256f5113d64ce2bb66b838
Matched: slwga.dll
Size: 15360 bytes
Creation; 20/11/2010 20:24:21
Modification; 20/11/2010 20:24:21
MD5; b6d6886149573278cba6abd44c4317f5
Matched: slwga.dll
Size: 14336 bytes
Creation; 20/11/2010 20:23:48
Modification; 20/11/2010 20:23:48
MD5; 19f75d71e4256f5113d64ce2bb66b838
Matched: slwga.dll
Size: 15360 bytes
Creation; 20/11/2010 20:24:21
Modification; 20/11/2010 20:24:21
MD5; b6d6886149573278cba6abd44c4317f5
Matched: slwga.dll
Size: 14336 bytes
Creation; 20/11/2010 20:23:48
Modification; 20/11/2010 20:23:48
MD5; 19f75d71e4256f5113d64ce2bb66b838
Matched: slwga.dll

WVCheck's Dir Dump
WVCheck found no known bad directories.

WVCheck's Missing File Check
WVCheck found no missing Windows files.

WVCheck's MBAM Quarantine Check
There were no bad files quarantined by MBAM.

WVCheck's HOSTS File Check
WVCheck found no bad lines in the hosts file.

WVCheck's MD5 Check
user32.dll - 5e0db2d8b2750543cd2ebb9ea8e6cdd3

-------- End of File, program close at 1744_23-04-2012 --------
  • 0




  • Topic Starter
  • Member
  • PipPipPip
  • 343 posts
And, I happen to have a Repair Disk I made already.
  • 0




  • Topic Starter
  • Member
  • PipPipPip
  • 343 posts
Hmm... There are 10 slots missing from my windows activation code. Assuming that it doesn't follow a strict alphanumerical syntax (which they probably do) that's about 36^10 possible permutations that someone would have to try in order to guess it. Public topic and all... :unsure:

Now I'm just being paranoid...
  • 0



    Anti-Malware Mammoth

  • Expert
  • 9,717 posts
Hi. :)

Hmm... There are 10 slots missing from my windows activation code. Assuming that it doesn't follow a strict alphanumerical syntax (which they probably do) that's about 36^10 possible permutations that someone would have to try in order to guess it. Public topic and all... :unsure:

The output is fine/not a cause for concern.

My PC is performing fine - apart from the possibility of the trojan breach of course

OK. For interest sake the result of the file I asked you to upload is good and no further action is required with regard to that.

And, I happen to have a Repair Disk I made already.

Good lets proceed as follows shall we...

Custom OTL Script:

  • Right-click OTL.exe and select Run as Administrator to start the program.
  • Copy the lines from the Quote box(do not copy the word Quote) to the clipboard by highlighting ALL of them and pressing CTRL + C (or, after highlighting, right-click and choose Copy):

O2:64bit: - BHO: (Java™ Plug-In 2 SSV Helper) - {DBC80044-A445-435b-BC74-9C25C1C588A9} - C:\Program Files\Java\jre6\bin\jp2ssv.dll File not found
O2:64bit: - BHO: (Hotspot Shield Class) - {F9E4A054-E9B1-4BC3-83A3-76A1AE736170} - C:\Program Files (x86)\Hotspot Shield\HssIE\HssIE_64.dll File not found
O2 - BHO: (Java™ Plug-In 2 SSV Helper) - {DBC80044-A445-435b-BC74-9C25C1C588A9} - C:\Program Files (x86)\Java\jre6\bin\jp2ssv.dll File not found
O4 - HKLM..\Run: [] File not found
O4 - HKLM..\Run: [NPSStartup] File not found
O4 - HKU\S-1-5-19..\RunOnce: [mctadmin] C:\Windows\System32\mctadmin.exe File not found
O4 - HKU\S-1-5-20..\RunOnce: [mctadmin] C:\Windows\System32\mctadmin.exe File not found
O4 - HKU\S-1-5-21-786879198-253778329-1393635891-1003..\RunOnce: [mctadmin] C:\Windows\System32\mctadmin.exe File not found
[2012/04/01 19:43:23 | 000,000,000 | ---D | C] -- C:\Program Files (x86)\Conduit
[4 C:\Windows\*.tmp files -> C:\Windows\*.tmp -> ]
[2012/04/18 17:41:54 | 000,005,676 | ---- | M] () -- C:\Users\Michal\AppData\Local\Temp5.html
[2012/04/18 17:41:12 | 000,001,955 | ---- | M] () -- C:\Users\Michal\AppData\Local\Temp1.html
[2012/04/02 20:51:02 | 000,282,864 | ---- | M] () -- C:\Windows\SysWow64\PnkBstrB.xtr
[2012/04/02 20:46:55 | 000,280,904 | ---- | M] () -- C:\Windows\SysWow64\PnkBstrB.ex0
[2012/01/14 22:02:31 | 000,008,341 | ---- | C] () -- C:\ProgramData\2be2b9a
[2012/01/14 22:02:31 | 000,008,338 | ---- | C] () -- C:\Users\Michal\AppData\Local\e5061498
[2012/01/14 22:02:31 | 000,008,276 | ---- | C] () -- C:\Users\Michal\AppData\Roaming\91d7245d
[2011/08/29 21:06:38 | 002,601,752 | ---- | C] () -- C:\Windows\SysWow64\pbsvc_moh.exe
[2011/07/30 22:02:18 | 002,434,856 | ---- | C] () -- C:\Windows\SysWow64\pbsvc_bc2.exe

ipconfig /flushdns /c


  • Return to OTL, right-click in the Custom Scans/Fixes window (under the cyan bar) and choose Paste.
  • Then click the red Run Fix button.
  • Let the program run unhindered.
  • If OTL asks to reboot your computer, allow it to do so. The report should appear in Notepad after the reboot.
Note: The logfile can also be located C: >> _OTL >> MovedFiles >> DD/DD/DD TT/TT.txt <-- denotes date/time log created.

Malwarebytes Anti-Malware:

Note: Remember to right click MBAM and select Run As Administrator.

  • Launch the application, Check for Updates >> Perform quick scan.
  • When the scan is complete, click OK, then Show Results to view the results.
  • Be sure that everything is checked, and click Remove Selected.
  • When completed, a log will open in Notepad. please copy and paste the log into your next reply.
Note: If MBAM encounters a file that is difficult to remove, you will be presented with 1 of 2 prompts, click OK to either and let MBAM proceed with the disinfection process, if asked to restart the computer, please do so immediately. Failure to reboot will prevent MBAM from removing all the malware.

When completed the above, please post back the following in the order asked for:

  • How is your computer performing now, any further symptoms and or problems encountered?
  • OTL Log from the Custom Script.
  • Malwarebytes Anti-Malware Log.

  • 0




  • Topic Starter
  • Member
  • PipPipPip
  • 343 posts
PC is running fine. It's a little sluggish after the reboot from the OTL script, but I suppose that's a side effect from that run. Besides that, nothing to report. OTL and MBAM logs incoming.


All processes killed
========== OTL ==========
64bit-Registry key HKEY_LOCAL_MACHINE\Software\Microsoft\Windows\CurrentVersion\Explorer\Browser Helper Objects\{DBC80044-A445-435b-BC74-9C25C1C588A9}\ deleted successfully.
64bit-Registry key HKEY_LOCAL_MACHINE\SOFTWARE\Classes\CLSID\{DBC80044-A445-435b-BC74-9C25C1C588A9}\ deleted successfully.
64bit-Registry key HKEY_LOCAL_MACHINE\Software\Microsoft\Windows\CurrentVersion\Explorer\Browser Helper Objects\{F9E4A054-E9B1-4BC3-83A3-76A1AE736170}\ deleted successfully.
64bit-Registry key HKEY_LOCAL_MACHINE\SOFTWARE\Classes\CLSID\{F9E4A054-E9B1-4BC3-83A3-76A1AE736170}\ deleted successfully.
Registry key HKEY_LOCAL_MACHINE\Software\Microsoft\Windows\CurrentVersion\Explorer\Browser Helper Objects\{DBC80044-A445-435b-BC74-9C25C1C588A9}\ deleted successfully.
Registry key HKEY_LOCAL_MACHINE\SOFTWARE\Classes\CLSID\{DBC80044-A445-435b-BC74-9C25C1C588A9}\ deleted successfully.
Registry value HKEY_LOCAL_MACHINE\Software\Microsoft\Windows\CurrentVersion\Run\\ deleted successfully.
Registry value HKEY_LOCAL_MACHINE\Software\Microsoft\Windows\CurrentVersion\Run\\NPSStartup deleted successfully.
Registry value HKEY_USERS\S-1-5-19\Software\Microsoft\Windows\CurrentVersion\RunOnce\\mctadmin deleted successfully.
Registry value HKEY_USERS\S-1-5-20\Software\Microsoft\Windows\CurrentVersion\RunOnce\\mctadmin deleted successfully.
Registry value HKEY_USERS\S-1-5-21-786879198-253778329-1393635891-1003\Software\Microsoft\Windows\CurrentVersion\RunOnce\\mctadmin deleted successfully.
C:\Program Files (x86)\Conduit\Community Alerts folder moved successfully.
C:\Program Files (x86)\Conduit folder moved successfully.
C:\Windows\64F6748976BB4CDDA236F954BE774B35.TMP\WiseCustomCalla.dll deleted successfully.
C:\Windows\64F6748976BB4CDDA236F954BE774B35.TMP folder deleted successfully.
C:\Windows\65F1CF6331E0450B96F34A88BE7361A6.TMP\WiseCustomCalla.dll deleted successfully.
C:\Windows\65F1CF6331E0450B96F34A88BE7361A6.TMP folder deleted successfully.
C:\Windows\8AAB4176A747493AA42CB63CFADFD8E3.TMP\WiseCustomCalla.dll deleted successfully.
C:\Windows\8AAB4176A747493AA42CB63CFADFD8E3.TMP folder deleted successfully.
C:\Windows\msdownld.tmp folder deleted successfully.
C:\Users\Michal\AppData\Local\Temp5.html moved successfully.
C:\Users\Michal\AppData\Local\Temp1.html moved successfully.
C:\Windows\SysWOW64\PnkBstrB.xtr moved successfully.
C:\Windows\SysWOW64\PnkBstrB.ex0 moved successfully.
C:\ProgramData\2be2b9a moved successfully.
C:\Users\Michal\AppData\Local\e5061498 moved successfully.
C:\Users\Michal\AppData\Roaming\91d7245d moved successfully.
C:\Windows\SysWOW64\pbsvc_moh.exe moved successfully.
C:\Windows\SysWOW64\pbsvc_bc2.exe moved successfully.
========== FILES ==========
< ipconfig /flushdns /c >
Windows IP Configuration
Successfully flushed the DNS Resolver Cache.
C:\Users\Michal\Desktop\cmd.bat deleted successfully.
C:\Users\Michal\Desktop\cmd.txt deleted successfully.
C:\Windows\prefetch\ACROBAT.EXE-CECD2CCA.pf moved successfully.
C:\Windows\prefetch\AgAppLaunch.db moved successfully.
C:\Windows\prefetch\AGCP.EXE-F32C532D.pf moved successfully.
C:\Windows\prefetch\AgCx_S1_S-1-5-21-786879198-253778329-1393635891-1000.snp.db moved successfully.
C:\Windows\prefetch\AgCx_S1_S-1-5-21-786879198-253778329-1393635891-1001.snp.db moved successfully.
C:\Windows\prefetch\AgCx_S2_S-1-5-21-786879198-253778329-1393635891-1000.snp.db moved successfully.
C:\Windows\prefetch\AgCx_S3_S-1-5-21-786879198-253778329-1393635891-1001.snp.db moved successfully.
C:\Windows\prefetch\AgCx_SC3_48704CE9875DDF7A.db moved successfully.
C:\Windows\prefetch\AgCx_SC3_52B9741AA37ECF2D.db moved successfully.
C:\Windows\prefetch\AgCx_SC4.db moved successfully.
C:\Windows\prefetch\AgGlFaultHistory.db moved successfully.
C:\Windows\prefetch\AgGlFgAppHistory.db moved successfully.
C:\Windows\prefetch\AgGlGlobalHistory.db moved successfully.
C:\Windows\prefetch\AgGlUAD_P_S-1-5-21-786879198-253778329-1393635891-1000.db moved successfully.
C:\Windows\prefetch\AgGlUAD_P_S-1-5-21-786879198-253778329-1393635891-1001.db moved successfully.
C:\Windows\prefetch\AgGlUAD_S-1-5-21-786879198-253778329-1393635891-1000.db moved successfully.
C:\Windows\prefetch\AgGlUAD_S-1-5-21-786879198-253778329-1393635891-1001.db moved successfully.
C:\Windows\prefetch\AgRobust.db moved successfully.
C:\Windows\prefetch\ALLSHAREDMS.EXE-A68710F6.pf moved successfully.
C:\Windows\prefetch\APPLEMOBILEDEVICESERVICE.EXE-3139FD6A.pf moved successfully.
C:\Windows\prefetch\ATBROKER.EXE-FF58B71D.pf moved successfully.
C:\Windows\prefetch\AUDIODG.EXE-D0D776AC.pf moved successfully.
C:\Windows\prefetch\BUBBLES.SCR-8E3A7BBC.pf moved successfully.
C:\Windows\prefetch\CALC.EXE-AC08706A.pf moved successfully.
C:\Windows\prefetch\CKSCANNER.EXE-FE1A8300.pf moved successfully.
C:\Windows\prefetch\CMD.EXE-89305D47.pf moved successfully.
C:\Windows\prefetch\CMD.EXE-EABFE48B.pf moved successfully.
C:\Windows\prefetch\COH64.EXE-BFD059AD.pf moved successfully.
C:\Windows\prefetch\COMUPDATUS.EXE-E730CFA8.pf moved successfully.
C:\Windows\prefetch\CONHOST.EXE-3218E401.pf moved successfully.
C:\Windows\prefetch\CSC.EXE-4EF173D0.pf moved successfully.
C:\Windows\prefetch\CSCRIPT.EXE-228E38AF.pf moved successfully.
C:\Windows\prefetch\CSRSS.EXE-8C04D631.pf moved successfully.
C:\Windows\prefetch\CVTRES.EXE-419E4E46.pf moved successfully.
C:\Windows\prefetch\DAEMONU.EXE-9B421CC1.pf moved successfully.
C:\Windows\prefetch\DLLHOST.EXE-491E9D91.pf moved successfully.
C:\Windows\prefetch\DLLHOST.EXE-6202E8F2.pf moved successfully.
C:\Windows\prefetch\DLLHOST.EXE-71214090.pf moved successfully.
C:\Windows\prefetch\DLLHOST.EXE-7A4F5DBA.pf moved successfully.
C:\Windows\prefetch\DLLHOST.EXE-893DDF55.pf moved successfully.
C:\Windows\prefetch\DLLHOST.EXE-FA51C347.pf moved successfully.
C:\Windows\prefetch\DPUPDCHK.EXE-3AA316EA.pf moved successfully.
C:\Windows\prefetch\DWHWIZRD.EXE-23F58817.pf moved successfully.
C:\Windows\prefetch\DWM.EXE-AEABE78B.pf moved successfully.
C:\Windows\prefetch\EXPLORER.EXE-7A3328DA.pf moved successfully.
C:\Windows\prefetch\FIREFOX.EXE-FBBD985A.pf moved successfully.
C:\Windows\prefetch\FLASHPLAYERUPDATESERVICE.EXE-41B177B8.pf moved successfully.
C:\Windows\prefetch\GTA4BROWSER.EXE-54E1E8D2.pf moved successfully.
C:\Windows\prefetch\GTAIV.EXE-466CE27D.pf moved successfully.
C:\Windows\prefetch\IEXPLORE.EXE-F6A52C86.pf moved successfully.
C:\Windows\prefetch\IPCONFIG.EXE-B327820A.pf moved successfully.
C:\Windows\prefetch\IPODSERVICE.EXE-FE1A6FF7.pf moved successfully.
C:\Windows\prefetch\ITYPE.EXE-DA456392.pf moved successfully.
C:\Windows\prefetch\LAUNCHGTAIV.EXE-5158855C.pf moved successfully.
C:\Windows\prefetch\Layout.ini moved successfully.
C:\Windows\prefetch\LOGONUI.EXE-1BEE4A84.pf moved successfully.
C:\Windows\prefetch\LUALL.EXE-1F16F64D.pf moved successfully.
C:\Windows\prefetch\LUCALLBACKPROXY.EXE-DB46B393.pf moved successfully.
C:\Windows\prefetch\LUCOMS~1.EXE-86297BBF.pf moved successfully.
C:\Windows\prefetch\MDNSRESPONDER.EXE-D5109358.pf moved successfully.
C:\Windows\prefetch\MGADIAG.EXE-5AFDC6E2.pf moved successfully.
C:\Windows\prefetch\MMC.EXE-F47113D9.pf moved successfully.
C:\Windows\prefetch\MPNOTIFY.EXE-55171BA9.pf moved successfully.
C:\Windows\prefetch\MSCONFIG.EXE-0B9585D9.pf moved successfully.
C:\Windows\prefetch\MSCORSVW.EXE-98F0699A.pf moved successfully.
C:\Windows\prefetch\MSCORSVW.EXE-FAA88858.pf moved successfully.
C:\Windows\prefetch\MSINFO32.EXE-664C8DF0.pf moved successfully.
C:\Windows\prefetch\NOTEPAD.EXE-28E040DE.pf moved successfully.
C:\Windows\prefetch\NOTEPAD.EXE-EB1B961A.pf moved successfully.
C:\Windows\prefetch\NTOSBOOT-B00DFAAD.pf moved successfully.
C:\Windows\prefetch\NVTRAY.EXE-7D357916.pf moved successfully.
C:\Windows\prefetch\NVVSVC.EXE-261BA731.pf moved successfully.
C:\Windows\prefetch\NVXDSYNC.EXE-297C5BB3.pf moved successfully.
C:\Windows\prefetch\OTL.EXE-A4A4BBCB.pf moved successfully.
C:\Windows\prefetch\OUTLOOK.EXE-5EF11CAE.pf moved successfully.
C:\Windows\prefetch\PDAGENT.EXE-E9194B81.pf moved successfully.
C:\Windows\prefetch\PDAGENTS1.EXE-8ADE01AD.pf moved successfully.
C:\Windows\prefetch\PERFECTDISK.EXE-390D5C36.pf moved successfully.
C:\Windows\prefetch\PfSvPerfStats.bin moved successfully.
C:\Windows\prefetch\PLUGIN-CONTAINER.EXE-78000DE6.pf moved successfully.
C:\Windows\prefetch\PRESENTATIONFONTCACHE.EXE-3C65D73B.pf moved successfully.
C:\Windows\prefetch\PRINTISOLATIONHOST.EXE-83C184C4.pf moved successfully.
C:\Windows\prefetch\RAVCPL64.EXE-61B16716.pf moved successfully.
C:\Windows\prefetch\RGSC.EXE-8FF71870.pf moved successfully.
C:\Windows\prefetch\RGSCLAUNCHER.EXE-E1E2D954.pf moved successfully.
C:\Windows\prefetch\RUNDLL32.EXE-61FE7673.pf moved successfully.
C:\Windows\prefetch\RUNDLL32.EXE-8B751A46.pf moved successfully.
C:\Windows\prefetch\RUNDLL32.EXE-D62B6BC5.pf moved successfully.
C:\Windows\prefetch\RUNDLL32.EXE-DD6260BD.pf moved successfully.
C:\Windows\prefetch\RUNDLL32.EXE-E6DAF608.pf moved successfully.
C:\Windows\prefetch\RUNDLL32.EXE-F452D79D.pf moved successfully.
C:\Windows\prefetch\RUNONCE.EXE-21038459.pf moved successfully.
C:\Windows\prefetch\SESCLU.EXE-9DC4CA8B.pf moved successfully.
C:\Windows\prefetch\SKYPE.EXE-27214B0A.pf moved successfully.
C:\Windows\prefetch\SLUI.EXE-A65918C4.pf moved successfully.
C:\Windows\prefetch\SMCGUI.EXE-9BC164A0.pf moved successfully.
C:\Windows\prefetch\SMSS.EXE-1DCD0EB1.pf moved successfully.
C:\Windows\prefetch\SPLWOW64.EXE-FBA11EAB.pf moved successfully.
C:\Windows\prefetch\SPPSVC.EXE-CBE91656.pf moved successfully.
C:\Windows\prefetch\SVCHOST.EXE-135A30D8.pf moved successfully.
C:\Windows\prefetch\SVCHOST.EXE-7488A139.pf moved successfully.
C:\Windows\prefetch\SVCHOST.EXE-8FD92526.pf moved successfully.
C:\Windows\prefetch\SVCHOST.EXE-93CEEE07.pf moved successfully.
C:\Windows\prefetch\SVCHOST.EXE-FFD3B0B3.pf moved successfully.
C:\Windows\prefetch\TASKENG.EXE-5BAF290C.pf moved successfully.
C:\Windows\prefetch\TASKHOST.EXE-437C05A8.pf moved successfully.
C:\Windows\prefetch\TASKMGR.EXE-72398DC0.pf moved successfully.
C:\Windows\prefetch\TRUSTEDINSTALLER.EXE-031B6478.pf moved successfully.
C:\Windows\prefetch\USERINIT.EXE-F39AB672.pf moved successfully.
C:\Windows\prefetch\VLC.EXE-39B02EDC.pf moved successfully.
C:\Windows\prefetch\VSSVC.EXE-04D079CC.pf moved successfully.
C:\Windows\prefetch\WARP.EXE-9457C6C4.pf moved successfully.
C:\Windows\prefetch\WATADMINSVC.EXE-2C15EC68.pf moved successfully.
C:\Windows\prefetch\WERFAULT.EXE-0897AE09.pf moved successfully.
C:\Windows\prefetch\WINLOGON.EXE-8163EECC.pf moved successfully.
C:\Windows\prefetch\WINWORD.EXE-0FC8A15F.pf moved successfully.
C:\Windows\prefetch\WMIADAP.EXE-369DF1CD.pf moved successfully.
C:\Windows\prefetch\WMIPRVSE.EXE-43972D0F.pf moved successfully.
C:\Windows\prefetch\WMIPRVSE.EXE-94D7CB13.pf moved successfully.
C:\Windows\prefetch\WMPLAYER.EXE-61D40ED1.pf moved successfully.
C:\Windows\prefetch\WMPNSCFG.EXE-DF1DD51A.pf moved successfully.
C:\Windows\prefetch\WUAUCLT.EXE-830BCC14.pf moved successfully.
C:\Windows\prefetch\WVCHECK.EXE-6777571F.pf moved successfully.
========== COMMANDS ==========
C:\Windows\System32\drivers\etc\Hosts moved successfully.
HOSTS file reset successfully


User: All Users

User: Default
->Temp folder emptied: 0 bytes
->Temporary Internet Files folder emptied: 0 bytes
->Flash cache emptied: 56468 bytes

User: Default User
->Temp folder emptied: 0 bytes
->Temporary Internet Files folder emptied: 0 bytes
->Flash cache emptied: 0 bytes

User: Michal
->Temp folder emptied: 5769428 bytes
->Temporary Internet Files folder emptied: 7741328 bytes
->Java cache emptied: 9525747 bytes
->FireFox cache emptied: 515457647 bytes
->Flash cache emptied: 66167 bytes

User: Public

User: UpdatusUser
->Temp folder emptied: 0 bytes
->Temporary Internet Files folder emptied: 0 bytes

User: Widomski
->Temp folder emptied: 3931 bytes
->Temporary Internet Files folder emptied: 58852121 bytes
->Java cache emptied: 2263695 bytes
->FireFox cache emptied: 49823022 bytes
->Flash cache emptied: 4914 bytes

%systemdrive% .tmp files removed: 0 bytes
%systemroot% .tmp files removed: 0 bytes
%systemroot%\System32 .tmp files removed: 0 bytes
%systemroot%\System32 (64bit) .tmp files removed: 0 bytes
%systemroot%\System32\drivers .tmp files removed: 0 bytes
Windows Temp folder emptied: 0 bytes
%systemroot%\system32\config\systemprofile\Local Settings\Temp folder emptied: 389 bytes
%systemroot%\sysnative\config\systemprofile\AppData\Local\Microsoft\Windows\Temporary Internet Files folder emptied: 33234 bytes
%systemroot%\sysnative\config\systemprofile\AppData\LocalLow\Sun\Java\Deployment folder emptied: 749 bytes
RecycleBin emptied: 0 bytes

Total Files Cleaned = 620.00 mb

Restore point Set: OTL Restore Point

OTL by OldTimer - Version log created on 04242012_205948

Files\Folders moved on Reboot...
C:\Users\Michal\AppData\Local\Temp\FXSAPIDebugLogFile.txt moved successfully.

Registry entries deleted on Reboot...


Malwarebytes' Anti-Malware

Database version: 912042501

Windows 6.1.7601 Service Pack 1
Internet Explorer 9.0.8112.16421

24/04/2012 9:12:38 PM
mbam-log-2012-04-24 (21-12-38).txt

Scan type: Quick scan
Objects scanned: 246658
Time elapsed: 2 minute(s), 48 second(s)

Memory Processes Infected: 0
Memory Modules Infected: 0
Registry Keys Infected: 0
Registry Values Infected: 0
Registry Data Items Infected: 0
Folders Infected: 0
Files Infected: 0

Memory Processes Infected:
(No malicious items detected)

Memory Modules Infected:
(No malicious items detected)

Registry Keys Infected:
(No malicious items detected)

Registry Values Infected:
(No malicious items detected)

Registry Data Items Infected:
(No malicious items detected)

Folders Infected:
(No malicious items detected)

Files Infected:
(No malicious items detected)
  • 0



    Anti-Malware Mammoth

  • Expert
  • 9,717 posts
Hi. :)

PC is running fine


It's a little sluggish after the reboot from the OTL script, but I suppose that's a side effect from that run.

OK this may be due to the fact some in-depth system maintenance would be in order once I give the all clear...However most likely because I included the actual prefetch folder to be cleared out in the custom OTL script.

Normally I would not bother with such on a W7 machine but thought it best to err on the side of caution in this instance due to the nature of previous infections. Though I do not recall such being the case recently but that may be just down to my old memory and I maybe should consider eating more fish to keep the synapses firing correctly! :lol:

Levity aside, after a few days of use your machine should be as was speed wise with no discernible side affects of flushing the aforementioned folder.


The version of Malwarebytes' Anti-Malware in use v1.50.1.1100 is out of date and should be v1.61.0.1400. Why this was not updated during the recent update prior to the last scan not sure but such can occur upon occasion for varying reasons.

Now please go to Start(Windows 7 Orb) >> Control Panel >> Programs and Features and remove the following (if present):

Malwarebytes' Anti-Malware

To do so click once on each of the below and click on Uninstall/Change and follow the prompts.

Note: Any problems uninstalling MBAM, download and run this tool.

To do so:-

Right-click on mbam-clean.exe and select Run as Administrator >> follow the prompts.


Please download Malwarebytes' Anti-Malware to your Desktop.

  • Right-click mbam-setup.exe and select Run as Administrator then follow the prompts to install the program.
  • At the end, be sure a checkmark is placed next to Update Malwarebytes' Anti-Malware and Launch Malwarebytes' Anti-Malware, then click Finish.
  • If an update is found, it will download and install the latest version.

    When the program loads, Decline the Malwarebytes' Anti-Malware Trial (You can activate this when we've finished, if you so wish)
  • Once the program has loaded, select Perform quick scan, then click Scan.
  • When the scan is complete, click OK, then Show Results to view the results.
  • Be sure that everything is checked, and click Remove Selected.
  • When completed, a log will open in Notepad. Please post that log in your next reply.
The log can also be found here:

  • Launch Malwarebytes' Anti-Malware
  • Click on the Logs radio tab.
Note: If MBAM encounters a file that is difficult to remove, you will be presented with 1 of 2 prompts, click OK to either and let MBAM proceed with the disinfection process, if asked to restart the computer, please do so immediately. Failure to reboot will prevent MBAM from removing all the malware.

ESET Online Scanner:

Note: You can use either Internet Explorer or Mozilla FireFox for this scan. You will however need to disable your current installed Anti-Virus, how to do so can be read here.

Windows 7 users: You will need to to right-click on the either the IE or FF icon in the Start Menu or Quick Launch Bar on the Taskbar and select Run as Administrator from the context menu.

  • Please go here to run the scan...

    Note: If using Mozilla Firefox you will need to download esetsmartinstaller_enu.exe when prompted then double click on it to install.
    All of the below instructions are compatible with either Internet Explorer or Mozilla FireFox.

  • Select the option YES, I accept the Terms of Use then click on: Posted Image
  • When prompted allow the Add-On/Active X to install.
  • Make sure that the option Remove found threats is Not checked, and the option Scan archives is checked.
  • Now click on Advanced Settings and select the following:
    • Scan for potentially unwanted applications
    • Scan for potentially unsafe applications
    • Enable Anti-Stealth Technology
  • Now click on: Posted Image
  • The virus signature database... will begin to download. Be patient this make take some time depending on the speed of your Internet Connection.
  • When completed the Online Scan will begin automatically.
  • Do not touch either the Mouse or keyboard during the scan otherwise it may stall.
  • When completed select Uninstall application on close if you so wish, make sure you copy the logfile first!
  • Now click on: Posted Image
  • Use notepad to open the logfile located at C:\Program Files (x86)/ESET/ESET Online Scanner\log.txt.
  • Copy and paste that log as a reply to this topic.
Note: Do not forget to re-enable your Anti-Virus application after running the above scan!

When completed the above, please post back the following in the order asked for:

  • How is your computer performing now, any further symptoms and or problems encountered?
  • New MBAM Log.
  • Eset Log.

  • 0




  • Topic Starter
  • Member
  • PipPipPip
  • 343 posts
Nothing new to report, PC is still performing fine.


Malwarebytes Anti-Malware (PRO)

Database version: v2012.04.27.01

Windows 7 Service Pack 1 x64 NTFS
Internet Explorer 9.0.8112.16421
Michal :: MICHAL-PC [administrator]

Protection: Disabled

26/04/2012 6:14:47 PM
mbam-log-2012-04-26 (18-14-47).txt

Scan type: Quick scan
Scan options enabled: Memory | Startup | Registry | File System | Heuristics/Extra | Heuristics/Shuriken | PUP | PUM | P2P
Scan options disabled:
Objects scanned: 247109
Time elapsed: 2 minute(s), 23 second(s)

Memory Processes Detected: 0
(No malicious items detected)

Memory Modules Detected: 0
(No malicious items detected)

Registry Keys Detected: 0
(No malicious items detected)

Registry Values Detected: 0
(No malicious items detected)

Registry Data Items Detected: 0
(No malicious items detected)

Folders Detected: 0
(No malicious items detected)

Files Detected: 0
(No malicious items detected)



C:\Program Files (x86)\Cheat Engine 6.1\cheatengine-i386.exe a variant of Win32/HackTool.CheatEngine.AB application
C:\Users\Michal\Downloads\bws-0487.rar a variant of Win32/GameHack.E application
C:\Windows\system64\agpcpq.dll Win64/Sirefef.W trojan
  • 0



    Anti-Malware Mammoth

  • Expert
  • 9,717 posts
Hi. :)

Nothing new to report, PC is still performing fine.


Custom OTL Script:

  • Right-click OTL.exe and select Run as Administrator to start the program.
  • Copy the lines from the quote-box(do not copy the word quote) to the clipboard by highlighting ALL of them and pressing CTRL + C (or, after highlighting, right-click and choose Copy):



  • Return to OTL, right-click in the Custom Scans/Fixes window (under the cyan bar) and choose Paste.
  • Then click the red Run Fix button.
  • Let the program run unhindered.
  • If OTL asks to reboot your computer, allow it to do so. The report should appear in Notepad after the reboot.
Note: The logfile can also be located C: >> _OTL >> MovedFiles >> DD/DD/DD TT/TT.txt <-- denotes date/time log created.

New Java Installation:

Note:- This is for the 32 bit version of Internet Explorer only.

  • Click here to visit Java's website.
  • Scroll down to Java SE 7u4. Click on JRE Download.
  • Check (tick) Java SE Runtime Environment 7u3 License Agreement box.
  • Click on jre-7u4-windows-i586.exe link next to Windows x86 Offline to download it and save this to your desktop.
  • Right-click on on jre-7u4-windows-i586.exe and select Run as Administrator to install Java.
If you also use the Internet Explorer (64-bit) browser with Windows 7 and want Java installed you will require a separate 64 bit installation as follows:-

New 64 bit Java Installation:

  • Click here to visit Java's website.
  • Scroll down to Java SE 7u4 . Click on JRE Download.
  • Check (tick) Java SE Runtime Environment 7u3 License Agreement box.
  • Click on jre-7u4-windows-x64.exe link next to Windows x64 to download it and save this and save this to your desktop.
  • Right-click on jre-7u4-windows-x64.exe and select Run as Administrator to install Java.

Let myself know when completed the above, post the log from the Custom OTL Scrip and if any further issues remaining. If not we will clean up all tools used during the Malware Removal process and I will provide some advice about online safety etc.
  • 0





  • Topic Starter
  • Member
  • PipPipPip
  • 343 posts
I ran the OTL fix above, and windows booted into startup repair, which failed to fix the problem. The diagnostic log afterwards stated that the "root cause" was that ntoskrnl.exe was corrupt. (File path: C:\Windows\System32\ntoskrnl.exe)

I thought that moving that system64 folder back in the script might have screwed something up, so I booted into ubuntu from a live CD and moved the folder back into C:\Windows\ from the OTL moved files folder but no joy. For now, I've undone that action. (I deleted the system64 folder from C:\Windows\, like it was after the script.)

Any thoughts?

I am posting the OTL log from the custom script, maybe it will be of some help.

*I also tried that aforementioned system repair disk, which didn't work either.

All processes killed

========== FILES ==========

C:\Windows\system64\zh-TW folder moved successfully.

C:\Windows\system64\zh-HK folder moved successfully.

C:\Windows\system64\zh-CN folder moved successfully.

C:\Windows\system64\winrm\0409 folder moved successfully.

C:\Windows\system64\winrm folder moved successfully.

C:\Windows\system64\winevt\TraceFormat folder moved successfully.

Folder move failed. C:\Windows\system64\winevt\Logs scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\winevt scheduled to be moved on reboot.

C:\Windows\system64\WindowsPowerShell\v1.0\Modules\TroubleshootingPack\en-US folder moved successfully.

Folder move failed. C:\Windows\system64\WindowsPowerShell\v1.0\Modules\TroubleshootingPack scheduled to be moved on reboot.

C:\Windows\system64\WindowsPowerShell\v1.0\Modules\PSDiagnostics folder moved successfully.

C:\Windows\system64\WindowsPowerShell\v1.0\Modules\BitsTransfer\en-US folder moved successfully.

Folder move failed. C:\Windows\system64\WindowsPowerShell\v1.0\Modules\BitsTransfer scheduled to be moved on reboot.

C:\Windows\system64\WindowsPowerShell\v1.0\Modules\AppLocker\en-US folder moved successfully.

Folder move failed. C:\Windows\system64\WindowsPowerShell\v1.0\Modules\AppLocker scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\WindowsPowerShell\v1.0\Modules scheduled to be moved on reboot.

C:\Windows\system64\WindowsPowerShell\v1.0\Examples folder moved successfully.

Folder move failed. C:\Windows\system64\WindowsPowerShell\v1.0\en-US scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\WindowsPowerShell\v1.0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\WindowsPowerShell scheduled to be moved on reboot.

C:\Windows\system64\WinBioPlugIns\en-US folder moved successfully.

Folder move failed. C:\Windows\system64\WinBioPlugIns scheduled to be moved on reboot.

C:\Windows\system64\WinBioDatabase folder moved successfully.

C:\Windows\system64\wfp folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{f0616ead-a00e-4962-b9de-94b907702c57} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{ee67f482-b852-4e7e-a9fd-b924bb37ed62} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{d6e21354-d0ff-4349-ba43-6f132afed60d} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{c6e31fac-f934-4c23-b6ba-7b3e7a05372c} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{c3483aec-bfd6-4fc8-a3ec-c559fd83cd8c} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{bce425bc-74a0-4751-95f6-85dad34c094c} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{b9391c65-a739-47a1-b122-d494fe16ae5f} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{b88c83ab-6ac8-4b94-912e-042ef133fd43} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{b0bb51a8-9380-4126-a4c7-96ad49fc44ac} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{aff0d274-7c36-4b22-98f3-c176d85afd12} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{ab38070b-81db-45d7-bda7-3a234e0a32d7} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{a4898c27-2aed-4f20-b37f-49fe8c611135} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{a0278af0-dd80-41e3-b0ba-1ab0599b9cab} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{8f870333-2d4f-4364-936f-27327e19b50a} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{8e604316-4a75-4e24-8cac-6de4515d2fe1} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{6e960550-4cc7-41a5-b7e1-0738c5ce868f} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{6c379005-e78b-400c-ae46-38e294da05a5} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{67f469c6-0944-4ff8-b913-acfab8226993} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{5f95172c-8706-497d-bf8f-17c4148396ae} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{4776308b-4092-4109-a03c-5600cc81f1d0} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{3904acb6-2e78-4b86-b311-499055bda50c} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{3439002f-7408-42bc-9891-6b367de5385b} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{30dcc4f8-7954-4783-8485-132c3ee050d1} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{269e375d-568f-40f6-93e8-b05cebe6c382} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{1f201d78-f004-47d8-b257-9f46ab31d3e9} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{181aec2d-35b6-4600-a118-e9c975b49c30} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{15caae0d-12ba-4ee4-a707-5743fd448336} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{0e3da15d-c73d-4f78-9017-73f1a5912c37} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d}\{02656149-d4c0-42e9-a67c-8e56d9053dc9} folder moved successfully.

C:\Windows\system64\wdi\{86432a0b-3c7d-4ddf-a89c-172faa90485d} folder moved successfully.

C:\Windows\system64\wdi\{67144949-5132-4859-8036-a737b43825d8}\{f862abb9-b629-42b7-9a63-cb7714204c26} folder moved successfully.

C:\Windows\system64\wdi\{67144949-5132-4859-8036-a737b43825d8}\{ee78cda9-49d9-4b6b-951a-a0aefe5bd884} folder moved successfully.

C:\Windows\system64\wdi\{67144949-5132-4859-8036-a737b43825d8}\{cf8978f9-c049-4b5c-85ab-d836e6c9f3d4} folder moved successfully.

C:\Windows\system64\wdi\{67144949-5132-4859-8036-a737b43825d8}\{c47e34ed-4306-43c3-b924-18961b798b06} folder moved successfully.

C:\Windows\system64\wdi\{67144949-5132-4859-8036-a737b43825d8}\{809ef01a-c8bc-4b15-8912-ca4e54032ee1} folder moved successfully.

C:\Windows\system64\wdi\{67144949-5132-4859-8036-a737b43825d8}\{5ee58fc3-2f9f-4aed-9b81-605aecc47625} folder moved successfully.

C:\Windows\system64\wdi\{67144949-5132-4859-8036-a737b43825d8}\{11d76895-a06b-4189-b92b-3e31e3ba362e} folder moved successfully.

C:\Windows\system64\wdi\{67144949-5132-4859-8036-a737b43825d8}\{11068532-d080-4d78-9e39-afd43e668d18} folder moved successfully.

C:\Windows\system64\wdi\{67144949-5132-4859-8036-a737b43825d8} folder moved successfully.

C:\Windows\system64\wdi\perftrack\traces folder moved successfully.

C:\Windows\system64\wdi\perftrack folder moved successfully.

Folder move failed. C:\Windows\system64\wdi\LogFiles scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\wdi scheduled to be moved on reboot.

C:\Windows\system64\WCN\en-US folder moved successfully.

C:\Windows\system64\WCN folder moved successfully.

C:\Windows\system64\wbem\xml folder moved successfully.

C:\Windows\system64\wbem\tmf folder moved successfully.

Folder move failed. C:\Windows\system64\wbem\Repository scheduled to be moved on reboot.

C:\Windows\system64\wbem\Performance folder moved successfully.

C:\Windows\system64\wbem\MOF\good folder moved successfully.

C:\Windows\system64\wbem\MOF\bad folder moved successfully.

C:\Windows\system64\wbem\MOF folder moved successfully.

C:\Windows\system64\wbem\Logs folder moved successfully.

C:\Windows\system64\wbem\en-US folder moved successfully.

C:\Windows\system64\wbem\AutoRecover folder moved successfully.

Folder move failed. C:\Windows\system64\wbem scheduled to be moved on reboot.

C:\Windows\system64\Wat folder moved successfully.

C:\Windows\system64\uk-UA folder moved successfully.

C:\Windows\system64\tr-TR folder moved successfully.

C:\Windows\system64\th-TH folder moved successfully.

C:\Windows\system64\Tasks\WPD folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows Live\SOXE folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows Live folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows Defender folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\WindowsColorSystem folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\WindowsBackup folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Windows Media Sharing folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Windows Filtering Platform folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Windows Error Reporting folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Windows Activation Technologies folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\WDI folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\User Profile Service folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\UPnP folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Time Synchronization folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\TextServicesFramework folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Tcpip folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Task Manager folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\SystemRestore folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\SyncCenter folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\SoftwareProtectionPlatform folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\SideShow folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Shell folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\RemoteAssistance folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\RemoteApp and Desktop Connections Update folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Registry folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Ras folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\RAC folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Power Efficiency Diagnostics folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\PLA\System folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\PLA folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\PerfTrack folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Offline Files folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\NetworkAccessProtection folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\NetTrace folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Multimedia folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\MUI folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\MobilePC folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\MemoryDiagnostic folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Media Center\Extender folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Media Center folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Maintenance folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Location folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\DiskDiagnostic folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Diagnosis folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Defrag folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Customer Experience Improvement Program folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\CertificateServicesClient folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Bluetooth folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Autochk folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Application Experience folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\AppID folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows\Active Directory Rights Management Services Client folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Windows folder moved successfully.

C:\Windows\system64\Tasks\Microsoft\Internet Explorer folder moved successfully.

C:\Windows\system64\Tasks\Microsoft folder moved successfully.

C:\Windows\system64\Tasks\Leader Technologies folder moved successfully.

C:\Windows\system64\Tasks folder moved successfully.

C:\Windows\system64\sysprep\Panther\IE folder moved successfully.

C:\Windows\system64\sysprep\Panther folder moved successfully.

C:\Windows\system64\sysprep\en-US folder moved successfully.

Folder move failed. C:\Windows\system64\sysprep scheduled to be moved on reboot.

C:\Windows\system64\sv-SE folder moved successfully.

C:\Windows\system64\sr-Latn-CS folder moved successfully.

C:\Windows\system64\sppui folder moved successfully.

C:\Windows\system64\spp\tokens\skus\Security-SPP-Component-SKU-Ultimate folder moved successfully.

C:\Windows\system64\spp\tokens\skus folder moved successfully.

C:\Windows\system64\spp\tokens\ppdlic folder moved successfully.

C:\Windows\system64\spp\tokens\pkeyconfig folder moved successfully.

C:\Windows\system64\spp\tokens\issuance folder moved successfully.

C:\Windows\system64\spp\tokens\identity folder moved successfully.

C:\Windows\system64\spp\tokens\channels\OCUR folder moved successfully.

C:\Windows\system64\spp\tokens\channels folder moved successfully.

C:\Windows\system64\spp\tokens folder moved successfully.

C:\Windows\system64\spp\plugin-manifests-signed folder moved successfully.

C:\Windows\system64\spp folder moved successfully.

C:\Windows\system64\spool\tools\Microsoft XPS Document Writer folder moved successfully.

C:\Windows\system64\spool\tools\en-US folder moved successfully.

Folder move failed. C:\Windows\system64\spool\tools scheduled to be moved on reboot.

C:\Windows\system64\spool\SERVERS folder moved successfully.

C:\Windows\system64\spool\prtprocs\x64\en-US folder moved successfully.

C:\Windows\system64\spool\prtprocs\x64 folder moved successfully.

C:\Windows\system64\spool\prtprocs folder moved successfully.

C:\Windows\system64\spool\PRINTERS folder moved successfully.

C:\Windows\system64\spool\drivers\x64\PCC folder moved successfully.

C:\Windows\system64\spool\drivers\x64\3\mui\0409 folder moved successfully.

C:\Windows\system64\spool\drivers\x64\3\mui folder moved successfully.

C:\Windows\system64\spool\drivers\x64\3\en-US folder moved successfully.

C:\Windows\system64\spool\drivers\x64\3 folder moved successfully.

C:\Windows\system64\spool\drivers\x64 folder moved successfully.

C:\Windows\system64\spool\drivers\W32X86\3 folder moved successfully.

C:\Windows\system64\spool\drivers\W32X86 folder moved successfully.

C:\Windows\system64\spool\drivers\IA64 folder moved successfully.

C:\Windows\system64\spool\drivers\color folder moved successfully.

C:\Windows\system64\spool\drivers folder moved successfully.

Folder move failed. C:\Windows\system64\spool scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\Speech\SpeechUX\en-US scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\Speech\SpeechUX\en-gb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\Speech\SpeechUX scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\Speech\Engines\SR\en-US scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\Speech\Engines\SR scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\Speech\Engines scheduled to be moved on reboot.

C:\Windows\system64\Speech\Common folder moved successfully.

Folder move failed. C:\Windows\system64\Speech scheduled to be moved on reboot.

C:\Windows\system64\SMI\Store\Machine folder moved successfully.

C:\Windows\system64\SMI\Store folder moved successfully.

C:\Windows\system64\SMI\Schema folder moved successfully.

C:\Windows\system64\SMI\Manifests folder moved successfully.

C:\Windows\system64\SMI folder moved successfully.

C:\Windows\system64\slmgr\0409 folder moved successfully.

C:\Windows\system64\slmgr folder moved successfully.

C:\Windows\system64\sl-SI folder moved successfully.

C:\Windows\system64\sk-SK folder moved successfully.

C:\Windows\system64\Setup\en-US folder moved successfully.

Folder move failed. C:\Windows\system64\Setup scheduled to be moved on reboot.

C:\Windows\system64\ru-RU folder moved successfully.

C:\Windows\system64\ro-RO folder moved successfully.

C:\Windows\system64\restore folder moved successfully.

C:\Windows\system64\Recovery folder moved successfully.

C:\Windows\system64\ras folder moved successfully.

C:\Windows\system64\pt-PT folder moved successfully.

C:\Windows\system64\pt-BR folder moved successfully.

C:\Windows\system64\Printing_Admin_Scripts\en-US folder moved successfully.

C:\Windows\system64\Printing_Admin_Scripts folder moved successfully.

C:\Windows\system64\pl-PL folder moved successfully.

C:\Windows\system64\oobe\en-US folder moved successfully.

Folder move failed. C:\Windows\system64\oobe scheduled to be moved on reboot.

C:\Windows\system64\nl-NL folder moved successfully.

C:\Windows\system64\NetworkList\Icons\StockIcons folder moved successfully.

C:\Windows\system64\NetworkList\Icons folder moved successfully.

C:\Windows\system64\NetworkList folder moved successfully.

C:\Windows\system64\NDF folder moved successfully.

C:\Windows\system64\nb-NO folder moved successfully.

C:\Windows\system64\MUI\dispspec folder moved successfully.

C:\Windows\system64\MUI\0409 folder moved successfully.

C:\Windows\system64\MUI folder moved successfully.

C:\Windows\system64\Msdtc\Trace folder moved successfully.

C:\Windows\system64\Msdtc folder moved successfully.

C:\Windows\system64\migwiz\replacementmanifests\WindowsSearchEngine folder moved successfully.

C:\Windows\system64\migwiz\replacementmanifests\Usb folder moved successfully.

C:\Windows\system64\migwiz\replacementmanifests\Microsoft-Windows-TerminalServices-LicenseServer folder moved successfully.

C:\Windows\system64\migwiz\replacementmanifests\Microsoft-Windows-TerminalServices-AppServer-Licensing folder moved successfully.

C:\Windows\system64\migwiz\replacementmanifests\microsoft-windows-shmig folder moved successfully.

C:\Windows\system64\migwiz\replacementmanifests\Microsoft-Windows-OfflineFiles-Core folder moved successfully.

C:\Windows\system64\migwiz\replacementmanifests\microsoft-windows-ndis folder moved successfully.

C:\Windows\system64\migwiz\replacementmanifests\microsoft-windows-iis-rm folder moved successfully.

C:\Windows\system64\migwiz\replacementmanifests\Microsoft-Windows-GameUXMig folder moved successfully.

C:\Windows\system64\migwiz\replacementmanifests\microsoft-windows-audio-mmecore-other folder moved successfully.

C:\Windows\system64\migwiz\replacementmanifests\microsoft-international-core folder moved successfully.

C:\Windows\system64\migwiz\replacementmanifests\microsoft-activedirectory-webservices folder moved successfully.

Folder move failed. C:\Windows\system64\migwiz\replacementmanifests scheduled to be moved on reboot.

C:\Windows\system64\migwiz\PostMigRes\Web\base_images folder moved successfully.

Folder move failed. C:\Windows\system64\migwiz\PostMigRes\Web scheduled to be moved on reboot.

C:\Windows\system64\migwiz\PostMigRes\data folder moved successfully.

Folder move failed. C:\Windows\system64\migwiz\PostMigRes scheduled to be moved on reboot.

C:\Windows\system64\migwiz\en-US folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Networking-MPSSVC-Svc folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-WMI-Core folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-Unimodem-Config folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-TextServicesFramework-Migration-DL folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-TapiSetup folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-Sxs folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-StorageMigration folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-shmig-DL folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-RasServer-MigPlugin folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-RasConnectionManager folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-RasApi folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-PerformanceCounterInfrastructure-DL folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-OfflineFiles-DL folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-NetworkLoadBalancing-Core folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-NetworkBridge folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-NDIS folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-msmq-messagingcoreservice folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-MediaPlayer-DRM-DL folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-MediaPlayer folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-International-Core-DL folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-IIS-DL folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-IE-ESC folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-IasServer-MigPlugin folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-DirectoryServices-ADAM-DL folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-DHCPServerMigPlugin-DL folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-COM-DTC-Setup-DL folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-COM-ComPlus-Setup-DL folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-Bluetooth-Config folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-Windows-ADFS-DL folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\Microsoft-ActiveDirectory-WebServices-DL folder moved successfully.

C:\Windows\system64\migwiz\dlmanifests\BITSExtensions-Server folder moved successfully.

Folder move failed. C:\Windows\system64\migwiz\dlmanifests scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\migwiz scheduled to be moved on reboot.

C:\Windows\system64\migration\WSMT\rras\replacementmanifests\Microsoft-Windows-RasServer-MigPlugin folder moved successfully.

C:\Windows\system64\migration\WSMT\rras\replacementmanifests\Microsoft-Windows-RasApi-MigPlugin folder moved successfully.

Folder move failed. C:\Windows\system64\migration\WSMT\rras\replacementmanifests scheduled to be moved on reboot.

C:\Windows\system64\migration\WSMT\rras\dlmanifests\Microsoft-Windows-RasServer-MigPlugin folder moved successfully.

Folder move failed. C:\Windows\system64\migration\WSMT\rras\dlmanifests scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\migration\WSMT\rras scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\migration\WSMT scheduled to be moved on reboot.

C:\Windows\system64\migration\en-US folder moved successfully.

Folder move failed. C:\Windows\system64\migration scheduled to be moved on reboot.

C:\Windows\system64\Microsoft\Protect\S-1-5-18\User folder moved successfully.

C:\Windows\system64\Microsoft\Protect\S-1-5-18 folder moved successfully.

C:\Windows\system64\Microsoft\Protect\Recovery folder moved successfully.

C:\Windows\system64\Microsoft\Protect folder moved successfully.

C:\Windows\system64\Microsoft folder moved successfully.

C:\Windows\system64\manifeststore folder moved successfully.

C:\Windows\system64\Macromed\Flash folder moved successfully.

C:\Windows\system64\Macromed folder moved successfully.

C:\Windows\system64\lv-LV folder moved successfully.

C:\Windows\system64\lt-LT folder moved successfully.

Folder move failed. C:\Windows\system64\LogFiles\WUDF scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\LogFiles\WMI\RtBackup scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\LogFiles\WMI scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\LogFiles\SQM scheduled to be moved on reboot.

C:\Windows\system64\LogFiles\Scm folder moved successfully.

Folder move failed. C:\Windows\system64\LogFiles scheduled to be moved on reboot.

C:\Windows\system64\ko-KR folder moved successfully.

C:\Windows\system64\ja-JP folder moved successfully.

C:\Windows\system64\it-IT folder moved successfully.

C:\Windows\system64\inetsrv folder moved successfully.

C:\Windows\system64\IME\shared\res folder moved successfully.

Folder move failed. C:\Windows\system64\IME\shared scheduled to be moved on reboot.

C:\Windows\system64\IME\IMETC10\applets folder moved successfully.

Folder move failed. C:\Windows\system64\IME\IMETC10 scheduled to be moved on reboot.

C:\Windows\system64\IME\IMESC5\applets folder moved successfully.

Folder move failed. C:\Windows\system64\IME\IMESC5 scheduled to be moved on reboot.

C:\Windows\system64\IME\imekr8\dicts folder moved successfully.

C:\Windows\system64\IME\imekr8\applets folder moved successfully.

Folder move failed. C:\Windows\system64\IME\imekr8 scheduled to be moved on reboot.

C:\Windows\system64\IME\IMEJP10\APPLETS folder moved successfully.

Folder move failed. C:\Windows\system64\IME\IMEJP10 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\IME scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\icsxml scheduled to be moved on reboot.

C:\Windows\system64\ias folder moved successfully.

C:\Windows\system64\hu-HU folder moved successfully.

C:\Windows\system64\hr-HR folder moved successfully.

C:\Windows\system64\he-IL folder moved successfully.

C:\Windows\system64\GroupPolicyUsers folder moved successfully.

C:\Windows\system64\GroupPolicy\User folder moved successfully.

C:\Windows\system64\GroupPolicy\Machine folder moved successfully.

C:\Windows\system64\GroupPolicy folder moved successfully.

C:\Windows\system64\FxsTmp folder moved successfully.

C:\Windows\system64\fr-FR folder moved successfully.

C:\Windows\system64\fi-FI folder moved successfully.

C:\Windows\system64\et-EE folder moved successfully.

C:\Windows\system64\es-ES folder moved successfully.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\UltimateN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\UltimateE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\Ultimate scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\StarterN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\StarterE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\Starter scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\ProfessionalN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\ProfessionalE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\Professional scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\HomePremiumN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\HomePremiumE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\HomePremium scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\HomeBasicN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\HomeBasicE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\HomeBasic scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\EnterpriseN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\EnterpriseE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default\Enterprise scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\_Default scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\UltimateN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\UltimateE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\Ultimate scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\StarterN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\StarterE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\Starter scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\ProfessionalN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\ProfessionalE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\Professional scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\HomePremiumN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\HomePremiumE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\HomePremium scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\HomeBasicN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\HomeBasicE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\HomeBasic scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\EnterpriseN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\EnterpriseE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM\Enterprise scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\OEM scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\UltimateN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\UltimateE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\Ultimate scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\StarterN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\StarterE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\Starter scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\ProfessionalN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\ProfessionalE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\Professional scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\HomePremiumN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\HomePremiumE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\HomePremium scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\HomeBasicN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\HomeBasicE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\HomeBasic scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\EnterpriseN scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\EnterpriseE scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval\Enterprise scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses\eval scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US\Licenses scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\en-US scheduled to be moved on reboot.

C:\Windows\system64\en folder moved successfully.

C:\Windows\system64\el-GR folder moved successfully.

C:\Windows\system64\DRVSTORE\GEARAspiWD_B60A2DA9F47E0A7F3329B57AA751F1789961A8BE\x64 folder moved successfully.

C:\Windows\system64\DRVSTORE\GEARAspiWD_B60A2DA9F47E0A7F3329B57AA751F1789961A8BE folder moved successfully.

C:\Windows\system64\DRVSTORE folder moved successfully.

Folder move failed. C:\Windows\system64\DriverStore\Temp\{522f6bf6-ae20-0f66-d982-a746d010852a} scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\Temp scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\xnacc.inf_amd64_neutral_13c4e272a96185a1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\xcbdav.inf_amd64_neutral_cf80e4da1c95e6e2 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wvmic.inf_amd64_neutral_b94eb92e8150fa35 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wvmbusvideo.inf_amd64_neutral_8f9a8242d3699a44 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wvmbushid.inf_amd64_neutral_6708ad28050a6765 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wvmbus.inf_amd64_neutral_fca91999602b0343 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wudfusbcciddriver.inf_amd64_neutral_adc3e4acb1046b4b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wstorvsc.inf_amd64_neutral_d7bf942e99bb1d41 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wstorflt.inf_amd64_neutral_3db956c41708f7f5 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wsdscdrv.inf_amd64_neutral_47406488f9e8d5b8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wsdprint.inf_amd64_neutral_f91980f20f3112ed scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ws3cap.inf_amd64_neutral_eeaccb8f1560f5fb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wpdmtphw.inf_amd64_neutral_a7a22bb0bb81abb0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wpdmtp.inf_amd64_neutral_28f06ca2e38e8979 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wpdfs.inf_amd64_neutral_fc4ebadff3a40ae4 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wpdcomp.inf_amd64_neutral_11bbf54c8508434e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wnetvsc.inf_amd64_neutral_548addf09cb466fa scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\winusb.inf_amd64_neutral_6cb50ae9f480775b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\windowssideshowenhanceddriver.inf_amd64_neutral_184a2ef2a8f57c33 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiaxx002.inf_amd64_neutral_fbe080a7dd77c4a3 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiasa002.inf_amd64_neutral_6429a42f1243419a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wialx006.inf_amd64_neutral_ae607a72b46f9cfc scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wialx005.inf_amd64_neutral_5304c93e2193f237 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wialx004.inf_amd64_neutral_0a3a62ae6ed43127 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wialx003.inf_amd64_neutral_db618863f9347f9a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wialx002.inf_amd64_neutral_71f4aacee1aa9f06 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiaky002.inf_amd64_neutral_b898f5982403f3cb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiahp001.inf_amd64_neutral_aee49cdf3b352e58 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiaep003.inf_amd64_neutral_c2a98813147bf34e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiaep002.inf_amd64_neutral_0a982dec66379cb0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiacn001.inf_amd64_neutral_b7a0b2f53d745b5a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiaca00i.inf_amd64_neutral_de104aaa48ee4b00 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiaca00f.inf_amd64_neutral_f7f7e179d99acc58 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiaca00e.inf_amd64_neutral_5a376e6a7cb007d5 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiaca00d.inf_amd64_neutral_2c3623fa97b0c28e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiaca00c.inf_amd64_neutral_27f4ad26fea72eb1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiaca00b.inf_amd64_neutral_1aaa057d3d52ea43 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiaca00a.inf_amd64_neutral_163313056d8f34ab scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiabr00a.inf_amd64_neutral_6033065925bcc882 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiabr009.inf_amd64_neutral_2d7b3edfda95df40 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiabr008.inf_amd64_neutral_27d1c9a28eac4eed scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiabr007.inf_amd64_neutral_442d902f3f3dd5b7 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiabr006.inf_amd64_neutral_0232ca4f23224d01 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiabr005.inf_amd64_neutral_e14a0514f37611d8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiabr004.inf_amd64_neutral_b1d90b3749c5e6a6 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wiabr002.inf_amd64_neutral_b4ea26a49ad66560 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wdmvsc.inf_amd64_neutral_a2cf745000e2ea92 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wdma_usb.inf_amd64_neutral_7bb325bca8ea1218 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wdmaudio.inf_amd64_neutral_423894ded0ba8fdf scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wd.inf_amd64_neutral_759109899b486d47 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wceisvista.inf_amd64_neutral_3500779911f7f3ca scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\wave.inf_amd64_neutral_7a0a0b166f55e1aa scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\v_mscdsc.inf_amd64_neutral_8b1e6b55729c3283 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\vsmraid.inf_amd64_neutral_be11b7aaa746e92d scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\volume.inf_amd64_neutral_df8bea40ac96ca21 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\volsnap.inf_amd64_neutral_7499a4fac85b39fc scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\via_usb_modem.inf_amd64_neutral_2358dcbee0e9f747 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\via_usb_hub.inf_amd64_neutral_17426be7b4705102 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\via_usb_ets.inf_amd64_neutral_74f37c1f9f7c8ec2 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\vhdmp.inf_amd64_neutral_c3910bbf4fbccf97 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\usbvideo.inf_amd64_neutral_836a6716cd56c692 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\usbstor.inf_amd64_neutral_26b33263a639795d scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\usbstor.inf_amd64_neutral_0725c2806a159a9d scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\usbprint.inf_amd64_neutral_54948be2bc4bcdd1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\usbport.inf_amd64_neutral_f935002f367d5bb0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\usbport.inf_amd64_neutral_189259810882aaea scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\usbcir.inf_amd64_neutral_379fb0c62496be6e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\usbaapl64.inf_amd64_neutral_f9d62789100b9e9b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\usb2ser_64.inf_amd64_neutral_fe607fffbb4447cb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\usb.inf_amd64_neutral_269d7150439b3372 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\usb.inf_amd64_neutral_153b489118ee37b8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\unknown.inf_amd64_neutral_5eb6ac70dd1a3ad0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\umpass.inf_amd64_neutral_e3be362bfab667d2 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\umbus.inf_amd64_neutral_2d4257afa2e35253 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\type64.inf_amd64_neutral_f72148371e0ae839 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ts_wpdmtp.inf_amd64_neutral_daa64ca27846aa23 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ts_generic.inf_amd64_neutral_1a5c861fdb3aab0e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\tsusbhubfilter.inf_amd64_neutral_d0615d6fd67bad03 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\tsusbhub.inf_amd64_neutral_c67606b3f53ae4d4 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\tsprint.inf_amd64_neutral_c48d421ad2c1e3e3\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\tsprint.inf_amd64_neutral_c48d421ad2c1e3e3 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\tsgenericusbdriver.inf_amd64_neutral_24c807694f614911 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\transfercable.inf_amd64_neutral_82f4c743c8996d67\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\transfercable.inf_amd64_neutral_82f4c743c8996d67 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\trans64.inf_amd64_neutral_77c46313d357e391 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\tpm.inf_amd64_neutral_d5bb6575cf91cd73 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\tiehdusb.inf_amd64_neutral_17f0d5450b8d64b6 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\termmou.inf_amd64_neutral_207a02df8e9e6552 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\termkbd.inf_amd64_neutral_e561157e16aa2357 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\teefer2_m.inf_amd64_neutral_60144dcad56b7b6e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\teefer2.inf_amd64_neutral_6b46cce2a400e499 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\teamviewervpn.inf_amd64_neutral_5e1dcb6f86e23dcd scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\tdibth.inf_amd64_neutral_6ad685957123daf1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\tape.inf_amd64_neutral_c6a6811d3d827dba scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\synth3dvsc.inf_amd64_neutral_bccbc5fb46a05558 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sti.inf_amd64_neutral_9d9a7113099a28a2 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\stexstor.inf_amd64_neutral_80ee226e29362f51 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ss_mdm2.inf_amd64_neutral_cf1c4663ef7c9a1d\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ss_mdm2.inf_amd64_neutral_cf1c4663ef7c9a1d scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ss_bus.inf_amd64_neutral_6d955f904c10c7ea\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ss_bus.inf_amd64_neutral_6d955f904c10c7ea scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ss_bsdm2.inf_amd64_neutral_0a371e51eb1c4f49\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ss_bsdm2.inf_amd64_neutral_0a371e51eb1c4f49 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ss_bmdm2.inf_amd64_neutral_0b4d9aff4bff4834\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ss_bmdm2.inf_amd64_neutral_0b4d9aff4bff4834 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ss_bbus.inf_amd64_neutral_c15b1b62bb89ce93\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ss_bbus.inf_amd64_neutral_c15b1b62bb89ce93 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sssdsdm2.inf_amd64_neutral_29ac14b64340ac80\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sssdsdm2.inf_amd64_neutral_29ac14b64340ac80 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sssdobx2.inf_amd64_neutral_3fd1f638c64396f1\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sssdobx2.inf_amd64_neutral_3fd1f638c64396f1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sssdmdm2.inf_amd64_neutral_1a6f106eaa620fcc\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sssdmdm2.inf_amd64_neutral_1a6f106eaa620fcc scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sssdbus.inf_amd64_neutral_2c086231d5030ed1\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sssdbus.inf_amd64_neutral_2c086231d5030ed1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssm_ser2.inf_amd64_neutral_90500022f5ee5502\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssm_ser2.inf_amd64_neutral_90500022f5ee5502 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssm_mdm2.inf_amd64_neutral_8a6ed9e25774e477\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssm_mdm2.inf_amd64_neutral_8a6ed9e25774e477 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssm_bus.inf_amd64_neutral_282b82799728f1c6\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssm_bus.inf_amd64_neutral_282b82799728f1c6 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssecunic.inf_amd64_neutral_e37043d36926d065\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssecunic.inf_amd64_neutral_e37043d36926d065 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssecsdm2.inf_amd64_neutral_f8f2e725ef31735d\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssecsdm2.inf_amd64_neutral_f8f2e725ef31735d scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssecobx2.inf_amd64_neutral_28cee263fdbd49c1\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssecobx2.inf_amd64_neutral_28cee263fdbd49c1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssecndis.inf_amd64_neutral_c3c9e76d1fa7b1be\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssecndis.inf_amd64_neutral_c3c9e76d1fa7b1be scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssecmdm2.inf_amd64_neutral_7650de2ad52e799c\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssecmdm2.inf_amd64_neutral_7650de2ad52e799c scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssecbus.inf_amd64_neutral_0745b2a227fcff7a\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssecbus.inf_amd64_neutral_0745b2a227fcff7a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssdudfu.inf_amd64_neutral_178084af5935a222\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssdudfu.inf_amd64_neutral_178084af5935a222 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sscesdm2.inf_amd64_neutral_5ba67db7c890f91a\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sscesdm2.inf_amd64_neutral_5ba67db7c890f91a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sscemdm2.inf_amd64_neutral_74f4a27de2bbc485\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sscemdm2.inf_amd64_neutral_74f4a27de2bbc485 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sscebus.inf_amd64_neutral_910b5c17945c9460\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sscebus.inf_amd64_neutral_910b5c17945c9460 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sscdw2k.inf_amd64_neutral_f10c2995a60f0dbb\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sscdw2k.inf_amd64_neutral_f10c2995a60f0dbb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sscdsdm2.inf_amd64_neutral_81a4504f027ce380\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sscdsdm2.inf_amd64_neutral_81a4504f027ce380 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sscdbus.inf_amd64_neutral_778ff86e71c86806\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sscdbus.inf_amd64_neutral_778ff86e71c86806 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssbcmdm2.inf_amd64_neutral_213d8cdcfe2b0ef6\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssbcmdm2.inf_amd64_neutral_213d8cdcfe2b0ef6 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssbcbus.inf_amd64_neutral_6a998f5fe26c7a34\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssbcbus.inf_amd64_neutral_6a998f5fe26c7a34 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssaeunic.inf_amd64_neutral_f251edfe6ddfd1bf\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssaeunic.inf_amd64_neutral_f251edfe6ddfd1bf scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssaendis.inf_amd64_neutral_2a09a18b89bd4cb6\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssaendis.inf_amd64_neutral_2a09a18b89bd4cb6 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssaemdm2.inf_amd64_neutral_aab4956d58316cca\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssaemdm2.inf_amd64_neutral_aab4956d58316cca scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssaebus.inf_amd64_neutral_52d5c961892b3d6b\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssaebus.inf_amd64_neutral_52d5c961892b3d6b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssaeadb2.inf_amd64_neutral_be801ca834b05d87\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssaeadb2.inf_amd64_neutral_be801ca834b05d87 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssadsdm2.inf_amd64_neutral_45a994feb72d6be8\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssadsdm2.inf_amd64_neutral_45a994feb72d6be8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssadndis.inf_amd64_neutral_85de87d4e6cd3ac6 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssadmdm2.inf_amd64_neutral_003aac8dad140898\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssadmdm2.inf_amd64_neutral_003aac8dad140898 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssadbus.inf_amd64_neutral_352a2e9ed9948737\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssadbus.inf_amd64_neutral_352a2e9ed9948737 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssadadb2.inf_amd64_neutral_48ecccd082a260eb\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ssadadb2.inf_amd64_neutral_48ecccd082a260eb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\smartcrd.inf_amd64_neutral_6fb75ea318f84fe5 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sisraid4.inf_amd64_neutral_65ab84e9830f6f4b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sisraid2.inf_amd64_neutral_845e008c32615283 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\silvrlnk.inf_amd64_neutral_078e67552d8149ff scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sffdisk.inf_amd64_neutral_d2425e60845d17d3 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sensorsalsdriver.inf_amd64_neutral_1c5bc8e71eb90127 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\secumdm2.inf_amd64_neutral_3188a136cdb27f07\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\secumdm2.inf_amd64_neutral_3188a136cdb27f07 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\secubus.inf_amd64_neutral_2485f81ced67332f\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\secubus.inf_amd64_neutral_2485f81ced67332f scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sdbus.inf_amd64_neutral_735aa3b5ee832f62 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\scsidev.inf_amd64_neutral_a7f5d9f34b621dca scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\scrawpdo.inf_amd64_neutral_4c228493af8567bb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\sbp2.inf_amd64_neutral_332943647e950ada scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\rndiscmp.inf_amd64_neutral_4ca64d28e1be8fa9 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ricoh.inf_amd64_neutral_66b4504d1fb1c857 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\rdvgwddm.inf_amd64_neutral_dd691eae66f3032d scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\rdpbus.inf_amd64_neutral_3b741ca76444b9c3 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\rdlsbuscbs.inf_amd64_neutral_351e56205fd4c200 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\rawsilo.inf_amd64_neutral_8eb7e6403ddbb7a8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ramdisk.inf_amd64_neutral_798b5d4dd3f22a07 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ql40xx2.inf_amd64_neutral_b95932400326817e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ql40xx.inf_amd64_neutral_77a826e5c0a07842 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ql2300.inf_amd64_neutral_ca8487daf77ff7cb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\qd3x64.inf_amd64_neutral_e8903726d63a3f07 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnxx002.inf_amd64_neutral_560fdd891b24f384\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnxx002.inf_amd64_neutral_560fdd891b24f384 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnts003.inf_amd64_neutral_33a68664c7e7ae4b\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnts003.inf_amd64_neutral_33a68664c7e7ae4b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnts002.inf_amd64_neutral_ad2aa922aa11af2c\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnts002.inf_amd64_neutral_ad2aa922aa11af2c scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnsv004.inf_amd64_neutral_fc4526bbfbd5feb1\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnsv004.inf_amd64_neutral_fc4526bbfbd5feb1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnsv003.inf_amd64_neutral_1e0c4fbb9b11b015\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnsv003.inf_amd64_neutral_1e0c4fbb9b11b015 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnsv002.inf_amd64_neutral_6ca80563d6148ee5\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnsv002.inf_amd64_neutral_6ca80563d6148ee5 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnso002.inf_amd64_neutral_c3b7ce4e6f71641f\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnso002.inf_amd64_neutral_c3b7ce4e6f71641f scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnsh002.inf_amd64_neutral_42b7a64f45c7554c\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnsh002.inf_amd64_neutral_42b7a64f45c7554c scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnsa002.inf_amd64_neutral_d9df1d04d8cbe336\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnsa002.inf_amd64_neutral_d9df1d04d8cbe336 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc00c.inf_amd64_neutral_53a58f4fd7d88575\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc00c.inf_amd64_neutral_53a58f4fd7d88575 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc00b.inf_amd64_neutral_3338d41663aad5fa\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc00b.inf_amd64_neutral_3338d41663aad5fa scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc00a.inf_amd64_neutral_565c5d04cc520c48\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc00a.inf_amd64_neutral_565c5d04cc520c48 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc007.inf_amd64_neutral_2df575afa0f7d35f\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc007.inf_amd64_neutral_2df575afa0f7d35f scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc006.inf_amd64_neutral_7e12a60cc98d3f89\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc006.inf_amd64_neutral_7e12a60cc98d3f89 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc005.inf_amd64_neutral_31e08a1c2f933124\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc005.inf_amd64_neutral_31e08a1c2f933124 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc004.inf_amd64_neutral_bbd3435eeaf576ee\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc004.inf_amd64_neutral_bbd3435eeaf576ee scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc003.inf_amd64_neutral_47e09b7cc0d9e993\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc003.inf_amd64_neutral_47e09b7cc0d9e993 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc002.inf_amd64_neutral_fdb6f2e252435905\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnrc002.inf_amd64_neutral_fdb6f2e252435905 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnok002.inf_amd64_neutral_616c1e9b7df7d5a9\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnok002.inf_amd64_neutral_616c1e9b7df7d5a9 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnod002.inf_amd64_neutral_a10c656b6c7c053c\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnod002.inf_amd64_neutral_a10c656b6c7c053c scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnnr004.inf_amd64_neutral_3319ff2548f89fd8\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnnr004.inf_amd64_neutral_3319ff2548f89fd8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnnr003.inf_amd64_neutral_c07c33bfb5764bdb\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnnr003.inf_amd64_neutral_c07c33bfb5764bdb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnnr002.inf_amd64_neutral_37896c5e81c8d488\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnnr002.inf_amd64_neutral_37896c5e81c8d488 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnms002.inf_amd64_neutral_d834e48846616289\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnms002.inf_amd64_neutral_d834e48846616289 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnms001.inf_amd64_neutral_9fe8503f82ce60fa scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnms001.inf_amd64_neutral_9b214cd9b78760aa scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00z.inf_amd64_neutral_aea50acf04a2db1d\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00z.inf_amd64_neutral_aea50acf04a2db1d scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00y.inf_amd64_neutral_977318f2317f5ddd\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00y.inf_amd64_neutral_977318f2317f5ddd scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00x.inf_amd64_neutral_808baf4e08594a59\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00x.inf_amd64_neutral_808baf4e08594a59 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00w.inf_amd64_neutral_d4c93bb2fbf75723\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00w.inf_amd64_neutral_d4c93bb2fbf75723 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00v.inf_amd64_neutral_86ff307c66080d00\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00v.inf_amd64_neutral_86ff307c66080d00 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00e.inf_amd64_neutral_0a4797d9b127d3a7\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00e.inf_amd64_neutral_0a4797d9b127d3a7 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00d.inf_amd64_neutral_ce7a0b4e23e432ad\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00d.inf_amd64_neutral_ce7a0b4e23e432ad scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00c.inf_amd64_neutral_79ebe29715d2fa47\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00c.inf_amd64_neutral_79ebe29715d2fa47 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00b.inf_amd64_neutral_89b555703683b583\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00b.inf_amd64_neutral_89b555703683b583 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00a.inf_amd64_neutral_a89d2c01c0f43dfd\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx00a.inf_amd64_neutral_a89d2c01c0f43dfd scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx009.inf_amd64_neutral_d4b76afd08f308fb\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx009.inf_amd64_neutral_d4b76afd08f308fb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx008.inf_amd64_neutral_75545721835fd863\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx008.inf_amd64_neutral_75545721835fd863 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx007.inf_amd64_neutral_0b796ee4978458e2\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx007.inf_amd64_neutral_0b796ee4978458e2 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx006.inf_amd64_neutral_cc725426972d1293\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx006.inf_amd64_neutral_cc725426972d1293 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx005.inf_amd64_neutral_f65eeb9bff6bd8f3\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx005.inf_amd64_neutral_f65eeb9bff6bd8f3 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx004.inf_amd64_neutral_2cf95f307381e481\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx004.inf_amd64_neutral_2cf95f307381e481 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx003.inf_amd64_neutral_d1510a8315a2ea0d\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx003.inf_amd64_neutral_d1510a8315a2ea0d scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx002.inf_amd64_neutral_12563574abbc36eb\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnlx002.inf_amd64_neutral_12563574abbc36eb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnle004.inf_amd64_neutral_beb9bf23b7202bff\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnle004.inf_amd64_neutral_beb9bf23b7202bff scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnle003.inf_amd64_neutral_c61883abf66ddb39\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnle003.inf_amd64_neutral_c61883abf66ddb39 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnle002.inf_amd64_neutral_c7564163ba063094\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnle002.inf_amd64_neutral_c7564163ba063094 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnky009.inf_amd64_neutral_8e54c9ff272b72f1\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnky009.inf_amd64_neutral_8e54c9ff272b72f1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnky008.inf_amd64_neutral_9f6abc54cbf095f2\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnky008.inf_amd64_neutral_9f6abc54cbf095f2 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnky007.inf_amd64_neutral_e637699044f367f3\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnky007.inf_amd64_neutral_e637699044f367f3 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnky006.inf_amd64_neutral_522043c34551b0c0\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnky006.inf_amd64_neutral_522043c34551b0c0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnky005.inf_amd64_neutral_8836be987024e6a9\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnky005.inf_amd64_neutral_8836be987024e6a9 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnky004.inf_amd64_neutral_5db759db19acd3ae\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnky004.inf_amd64_neutral_5db759db19acd3ae scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnky003.inf_amd64_neutral_fe7ea176f20ab839\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnky003.inf_amd64_neutral_fe7ea176f20ab839 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnky002.inf_amd64_neutral_525d9740c77e325f\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnky002.inf_amd64_neutral_525d9740c77e325f scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnkm005.inf_amd64_neutral_c03c9e328608873e\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnkm005.inf_amd64_neutral_c03c9e328608873e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnkm004.inf_amd64_neutral_d2aee42dc9c393ea\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnkm004.inf_amd64_neutral_d2aee42dc9c393ea scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnkm003.inf_amd64_neutral_48652cda3bb15180\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnkm003.inf_amd64_neutral_48652cda3bb15180 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnkm002.inf_amd64_neutral_7c42808e24ebff99\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnkm002.inf_amd64_neutral_7c42808e24ebff99 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnin004.inf_amd64_neutral_c8902ae660ab1360\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnin004.inf_amd64_neutral_c8902ae660ab1360 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnin003.inf_amd64_neutral_3a3c6293d0cda862\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnin003.inf_amd64_neutral_3a3c6293d0cda862 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnin002.inf_amd64_neutral_977d40799168c216\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnin002.inf_amd64_neutral_977d40799168c216 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnhp005.inf_amd64_neutral_914d6c300207814f\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnhp005.inf_amd64_neutral_914d6c300207814f scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnhp004.inf_amd64_neutral_53f688945cfc24cc\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnhp004.inf_amd64_neutral_53f688945cfc24cc scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnhp003.inf_amd64_neutral_4480210763997eb4\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnhp003.inf_amd64_neutral_4480210763997eb4 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnhp002.inf_amd64_neutral_04d05d1f6a90ea24\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnhp002.inf_amd64_neutral_04d05d1f6a90ea24 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prngt004.inf_amd64_neutral_f5bf8a7ba9dfff55\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prngt004.inf_amd64_neutral_f5bf8a7ba9dfff55 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prngt003.inf_amd64_neutral_8c9aae54a5673a35\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prngt003.inf_amd64_neutral_8c9aae54a5673a35 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prngt002.inf_amd64_neutral_df2060d80de9ff13\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prngt002.inf_amd64_neutral_df2060d80de9ff13 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnge001.inf_amd64_neutral_cfffa4143b3c4592\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnge001.inf_amd64_neutral_cfffa4143b3c4592 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnfx002.inf_amd64_neutral_b6dd354531184f64\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnfx002.inf_amd64_neutral_b6dd354531184f64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep00l.inf_amd64_neutral_f1fa021d2221e2c7\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep00l.inf_amd64_neutral_f1fa021d2221e2c7 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep00g.inf_amd64_neutral_2926840e245f88f6\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep00g.inf_amd64_neutral_2926840e245f88f6 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep00f.inf_amd64_neutral_a5f6001b957bd7e0\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep00f.inf_amd64_neutral_a5f6001b957bd7e0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep00e.inf_amd64_neutral_edc631ff41a34218\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep00e.inf_amd64_neutral_edc631ff41a34218 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep00d.inf_amd64_neutral_dd61103f3a2743d4\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep00d.inf_amd64_neutral_dd61103f3a2743d4 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep00c.inf_amd64_neutral_f0d9ddf52f04765c\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep00c.inf_amd64_neutral_f0d9ddf52f04765c scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep00b.inf_amd64_neutral_2e6b718b2b177506\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep00b.inf_amd64_neutral_2e6b718b2b177506 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep00a.inf_amd64_neutral_92a4c727cdf4c2f7\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep00a.inf_amd64_neutral_92a4c727cdf4c2f7 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep005.inf_amd64_neutral_f2fbc5759618d8fb\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep005.inf_amd64_neutral_f2fbc5759618d8fb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep004.inf_amd64_neutral_63b22bfb6b93eaba\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep004.inf_amd64_neutral_63b22bfb6b93eaba scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep003.inf_amd64_neutral_92ed2d842e0dd4ea\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep003.inf_amd64_neutral_92ed2d842e0dd4ea scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep002.inf_amd64_neutral_efc4a7485b172c07\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnep002.inf_amd64_neutral_efc4a7485b172c07 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00z.inf_amd64_neutral_27f402ce616c3ebc\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00z.inf_amd64_neutral_27f402ce616c3ebc scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00y.inf_amd64_neutral_64560c72e81f6ad7\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00y.inf_amd64_neutral_64560c72e81f6ad7 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00x.inf_amd64_neutral_eb0842aa932d01ee\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00x.inf_amd64_neutral_eb0842aa932d01ee scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00i.inf_amd64_neutral_09ff5ee0a0cf0233\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00i.inf_amd64_neutral_09ff5ee0a0cf0233 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00h.inf_amd64_neutral_96a8e38189e54d71\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00h.inf_amd64_neutral_96a8e38189e54d71 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00g.inf_amd64_neutral_6f76b14b2912fa55\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00g.inf_amd64_neutral_6f76b14b2912fa55 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00f.inf_amd64_neutral_777b6911d18869b7\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00f.inf_amd64_neutral_777b6911d18869b7 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00e.inf_amd64_neutral_651eeed98428be5e\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00e.inf_amd64_neutral_651eeed98428be5e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00d.inf_amd64_neutral_0600b2ba575729f4\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00d.inf_amd64_neutral_0600b2ba575729f4 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00c.inf_amd64_neutral_510c36849918ce92\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00c.inf_amd64_neutral_510c36849918ce92 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00b.inf_amd64_neutral_4412894f52d39895\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00b.inf_amd64_neutral_4412894f52d39895 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00a.inf_amd64_neutral_d64d696193e69d7b\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca00a.inf_amd64_neutral_d64d696193e69d7b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca003.inf_amd64_neutral_8e91d4aa9330d2f8\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnca003.inf_amd64_neutral_8e91d4aa9330d2f8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr00a.inf_amd64_neutral_e7f3f91e6832ef5c\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr00a.inf_amd64_neutral_e7f3f91e6832ef5c scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr009.inf_amd64_neutral_fd2ac5b9c40bd465\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr009.inf_amd64_neutral_fd2ac5b9c40bd465 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr008.inf_amd64_neutral_0540370b0b1e348e\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr008.inf_amd64_neutral_0540370b0b1e348e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr007.inf_amd64_neutral_add2acf1d573aef0\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr007.inf_amd64_neutral_add2acf1d573aef0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr006.inf_amd64_neutral_f156853def526447\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr006.inf_amd64_neutral_f156853def526447 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr005.inf_amd64_neutral_9e4cc05e0d4bcb33\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr005.inf_amd64_neutral_9e4cc05e0d4bcb33 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr004.inf_amd64_neutral_a78e168d6944619a\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr004.inf_amd64_neutral_a78e168d6944619a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr003.inf_amd64_neutral_dff45d1d0df04caf\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr003.inf_amd64_neutral_dff45d1d0df04caf scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr002.inf_amd64_neutral_db1d8c9efda9b3c0\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\prnbr002.inf_amd64_neutral_db1d8c9efda9b3c0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ph6xib64c1.inf_amd64_neutral_68c99681343e9b68 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ph6xib64c0.inf_amd64_neutral_a43df8f7441e1c61 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ph3xibc9.inf_amd64_neutral_ff3a566e4b6ba035 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ph3xibc8.inf_amd64_neutral_c93e7023ef90e637 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ph3xibc7.inf_amd64_neutral_348f512722c79525 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ph3xibc6.inf_amd64_neutral_2818f7b3b62bdd39 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ph3xibc5.inf_amd64_neutral_2270382453de2dbb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ph3xibc4.inf_amd64_neutral_310871d800afa82a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ph3xibc3.inf_amd64_neutral_1da6abc36a79974f scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ph3xibc2.inf_amd64_neutral_7621f5d62d77f42e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ph3xibc12.inf_amd64_neutral_ff7295ba5a46d63f scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ph3xibc11.inf_amd64_neutral_bb18e5f134c40c68 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ph3xibc10.inf_amd64_neutral_2c5d0c618dbfaf2a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ph3xibc1.inf_amd64_neutral_662220c3016bb4d0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ph3xibc0.inf_amd64_neutral_c24bcc939e6dfc23 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\pcmcia.inf_amd64_neutral_1678e66e0cbb04b2 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\oemwin2k.inf_amd64_neutral_38b8aee5d93fd631 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\oemfxa5b.inf_amd64_neutral_795b04fb4cdbe276 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\nv_lh.inf_amd64_neutral_bc69f20e3115af59 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\nv_disp.inf_amd64_neutral_81f8d9877ff94d5e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\nv_disp.inf_amd64_neutral_00937a2af8f2d0ad scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\nvstusb.inf_amd64_neutral_c348d888b0d5c373 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\nvraid.inf_amd64_neutral_dd659ed032d28a14 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\nvraid.inf_amd64_neutral_0276fc3b3ea60d41 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\nulhpopr.inf_amd64_neutral_e078ec466987bb3b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\nuidfltr.inf_amd64_neutral_e2adc5ed855c8905 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ntprint.inf_amd64_neutral_4616c3de1949be6d\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ntprint.inf_amd64_neutral_4616c3de1949be6d scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\nfrd960.inf_amd64_neutral_cfc8c0013e9ede68 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netxfx64.inf_amd64_neutral_3336ecb2950fdc45 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netxex64.inf_amd64_neutral_77b02fd738dca150 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netw5v64.inf_amd64_neutral_a6b778ba802632cc scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netvwifibus.inf_amd64_neutral_9d0740f32ce81d24 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netvg62a.inf_amd64_neutral_5817ae5135655364 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netvfx64.inf_amd64_neutral_194cb6d2ea3a486e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\nettun.inf_amd64_neutral_bd24fb174fabec97 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netrtx64.inf_amd64_neutral_410e89ed86071c9b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netrtl64.inf_amd64_neutral_0383c5de75359695 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netrndis.inf_amd64_neutral_4c56d83f6e4d75b0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netr7364.inf_amd64_neutral_68988e550e69a417 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netr28x.inf_amd64_neutral_c86d6d5c3810fc04 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netr28ux.inf_amd64_neutral_54f2470c084714e1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netnvma.inf_amd64_neutral_99bb33c9a5bedaea scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netnvm64.inf_amd64_neutral_59c2a018fe2cf0b4 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netmyk00.inf_amd64_neutral_9c0c35afdddc16d2 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netloop.inf_amd64_neutral_856142fd87f1c21a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netl260a.inf_amd64_neutral_085226e1dfe76c55 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netl1e64.inf_amd64_neutral_22118b1072f57433 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netl1c64.inf_amd64_neutral_30b0b06f47cab8cf scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netl160a.inf_amd64_neutral_f8bdd2cbac28a8fd scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netk57a.inf_amd64_neutral_8b26ad5d0cc037a9 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netirda.inf_amd64_neutral_93a886f96cea2847 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netimm.inf_amd64_neutral_9b64397618841a19 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\nethss_m.inf_amd64_neutral_a1f6680758544bc8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\nethss.inf_amd64_neutral_8028d194cee25616 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netg664.inf_amd64_neutral_b4e8ccc6ba210e97 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netevbda.inf_amd64_neutral_bab421df9c31cc81 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netefe3e.inf_amd64_neutral_b71dd3dadc5c3e27 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\nete1g3e.inf_amd64_neutral_7f08406e40c6ede2 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\nete1e3e.inf_amd64_neutral_f77725472d91b1d1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netbxnda.inf_amd64_neutral_c81780c5dcabd0a0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netbvbda.inf_amd64_neutral_2bfa4ea57bd5d74a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netbc664.inf_amd64_neutral_673d3dfb961e9b17 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netb57va.inf_amd64_neutral_6264e97d4fc12211 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netathrx.inf_amd64_neutral_905772087ff288af scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\netaapl64.inf_amd64_neutral_dc2cbd989eec1514 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\net8187se64.inf_amd64_neutral_c239ab5d36a3b3e9 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\net8187bv64.inf_amd64_neutral_d9eee378245b3b8b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\net8185.inf_amd64_neutral_4ab014d645098f5f scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\net44amd.inf_amd64_neutral_db76873d4261eb11 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\net1yx64.inf_amd64_neutral_ed16756f950857e8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\net1qx64.inf_amd64_neutral_85d10fa4c777b7be scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\net1kx64.inf_amd64_neutral_1f62482fbb9e52a5 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\multiprt.inf_amd64_neutral_988a34fc912eab54 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mtconfig.inf_amd64_neutral_4de24f49b5e60c45 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mstape.inf_amd64_neutral_c2bb3ef1c45cd5a1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\msports.inf_amd64_neutral_fdcfb86ce78678d1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\msmouse.inf_amd64_neutral_7a5f47d3150cc0eb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mshdc.inf_amd64_neutral_aad30bdeec04ea5e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\msdv.inf_amd64_neutral_571f87a277565224 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\msdsm.inf_amd64_neutral_be2b348981b2ef17 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\msdri.inf_amd64_neutral_86bb50f34c49ae71 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\msclmd.inf_amd64_neutral_413d17c790177eef scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mpio.inf_amd64_neutral_0c74c0f95001b61c scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\monitor.inf_amd64_neutral_ab477c4d805d044f scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\modemcsa.inf_amd64_neutral_b64a610f1f09f267 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mijxinput.inf_amd64_neutral_452fabe792a00d17\x64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mijxinput.inf_amd64_neutral_452fabe792a00d17 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mf.inf_amd64_neutral_b263d46928b97a9b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\memory.inf_amd64_neutral_c2d2c213c3138487 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\megasr.inf_amd64_neutral_30b367f92ca46598 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\megasas2.inf_amd64_neutral_599d713507780ed4 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\megasas.inf_amd64_neutral_395276dd9b7a7448 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmzyxlg.inf_amd64_neutral_14f9249844f1cf17 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmzyxel.inf_amd64_neutral_ed1f16b3d0cae908 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmzyp.inf_amd64_neutral_b64bd08009e7444f scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmzoom.inf_amd64_neutral_dd07287cee791f3c scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmx5560.inf_amd64_neutral_e853cea0022c059a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmwhql0.inf_amd64_neutral_23613e3dd9401f10 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmvv.inf_amd64_neutral_14cb440c800fe9fe scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmvdot.inf_amd64_neutral_714bc6a3a28b9f0f scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmusrsp.inf_amd64_neutral_a44611db70783ded scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmusrk1.inf_amd64_neutral_19cdebd3e1182874 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmusrgl.inf_amd64_neutral_d42522943de68905 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmusrg.inf_amd64_neutral_814744dd97ccf09f scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmusrf.inf_amd64_neutral_439e7d1dcac00aca scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmtron.inf_amd64_neutral_1121c7f92e9e3001 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmtkr.inf_amd64_neutral_8e3809aa77440c37 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmti.inf_amd64_neutral_4443b423d18c3ffc scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmtexas.inf_amd64_neutral_7572473d88d69307 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmtdkj7.inf_amd64_neutral_7c21481229e1e66c scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmtdkj6.inf_amd64_neutral_8087946c82068597 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmtdkj5.inf_amd64_neutral_15940559c66fe8d9 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmtdkj4.inf_amd64_neutral_c150a510c4b85ce7 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmtdkj3.inf_amd64_neutral_7e1053ab483310f6 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmtdkj2.inf_amd64_neutral_0cf7696e2236ca4e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmtdk.inf_amd64_neutral_e567adb271831b5d scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmsuprv.inf_amd64_neutral_31d10a1a73b4feaa scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmsupra.inf_amd64_neutral_c4fe81ea47c6df87 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmsupr3.inf_amd64_neutral_8416bd6e64a8e858 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmsun2.inf_amd64_neutral_242c76ad2e288fb4 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmsun1.inf_amd64_neutral_6184912bd8e5b438 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmsonyu.inf_amd64_neutral_45152a8a9362fb82 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmsmart.inf_amd64_neutral_829e8c7d1c8d5207 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmsii64.inf_amd64_neutral_d7409fccc5ef4078 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmsier.inf_amd64_neutral_622ad8125bbeeda8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmrock5.inf_amd64_neutral_cadd97421d121ebb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmrock4.inf_amd64_neutral_e45293c539584293 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmrock3.inf_amd64_neutral_9fdc5d710dd63e80 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmrock.inf_amd64_neutral_2ec26aaad7a9d419 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmracal.inf_amd64_neutral_857b8ff74e5a7073 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmpsion.inf_amd64_neutral_6e65ea91a16f922a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmpp.inf_amd64_neutral_a9cb77fe1985cd2c scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmpn1.inf_amd64_neutral_e44cc033b67e7d04 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmpin.inf_amd64_neutral_2415474b9db0a888 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmpenr.inf_amd64_neutral_34624840c3163a38 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmpace.inf_amd64_neutral_f5caca1789a3c28b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmosi.inf_amd64_neutral_932d048a735b47c2 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmoptn.inf_amd64_neutral_be2f30f68f2a5567 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmomrn3.inf_amd64_neutral_a87289088ec2cdf1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmolic.inf_amd64_neutral_a53ac1a125d227fc scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmnttte.inf_amd64_neutral_16d100fb6ba2e40f scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmnttp2.inf_amd64_neutral_d218c42ac8635704 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmnttp.inf_amd64_neutral_18b899bdc8a755fa scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmnttme.inf_amd64_neutral_ece4b1cc5aee6a38 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmnttd6.inf_amd64_neutral_ce587aa61510da51 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmnttd2.inf_amd64_neutral_9dcd97ab7a913b7a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmntt1.inf_amd64_neutral_ecf5cff2236b273a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmnova.inf_amd64_neutral_b52d8db82d8c3be9 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmnokia.inf_amd64_neutral_a8e9a41983d33a0b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmnis5t.inf_amd64_neutral_6c50ee5cb1ea2780 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmnis3t.inf_amd64_neutral_857ff0fa9c73850a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmnis2u.inf_amd64_neutral_de46607a02fe2552 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmnis1u.inf_amd64_neutral_15011483bd8465c4 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmneuhs.inf_amd64_neutral_d1563e8412461eea scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmmts.inf_amd64_neutral_b7f0a8d5f67c19e8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmmotou.inf_amd64_neutral_eb1d978f38f35bca scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmmoto1.inf_amd64_neutral_bf4b404852955eb4 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmmot64.inf_amd64_neutral_1abbad2f29c8fa08 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmmod.inf_amd64_neutral_5766736c47b90fff scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmminij.inf_amd64_neutral_7c300346e830b2dc scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmmhzel.inf_amd64_neutral_1292ec506cfc26db scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmmhrtz.inf_amd64_neutral_10affee00545fb45 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmmetri.inf_amd64_neutral_f89b8a357327f615 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmmega.inf_amd64_neutral_f9c441ed24f00358 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmmct.inf_amd64_neutral_15bb3ed734fbbeb3 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmmcom.inf_amd64_neutral_716a306ec3899e04 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmmcd.inf_amd64_neutral_49212f5920298e45 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmmc288.inf_amd64_neutral_c4a901dab689ad79 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmlucnt.inf_amd64_neutral_642a5ab3f2a1ae20 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmlasno.inf_amd64_neutral_c86d5b5e5fa8b48a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmlasat.inf_amd64_neutral_bc1469ba40fe2114 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmkortx.inf_amd64_neutral_1975687236603184 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmke.inf_amd64_neutral_3e4daa83122b1559 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmjf56e.inf_amd64_neutral_328dabbf0aeed9bc scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmisdn.inf_amd64_neutral_061c61abd3904560 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmirmdm.inf_amd64_neutral_fadec14b0a37b637 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmiodat.inf_amd64_neutral_839e9ee1a8736613 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdminfot.inf_amd64_neutral_fc6bcd80e9e6a3c3 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmhayes.inf_amd64_neutral_507db5d34d7acddc scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmhay2.inf_amd64_neutral_ff250f861d941dd8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmhandy.inf_amd64_neutral_386661b46df6da3f scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmhaeu.inf_amd64_neutral_6611a858035bf482 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmgsm.inf_amd64_neutral_dd3fbd8c64c7c87d scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmgl010.inf_amd64_neutral_46f466c9e68abb4a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmgl009.inf_amd64_neutral_bed6224f27f5c478 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmgl008.inf_amd64_neutral_d225e15af1a594cd scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmgl007.inf_amd64_neutral_935cd017fcb965ee scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmgl006.inf_amd64_neutral_e5693eb731048022 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmgl005.inf_amd64_neutral_8b56291bfd2a4061 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmgl004.inf_amd64_neutral_1874f16002601f78 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmgl003.inf_amd64_neutral_4c78da9e48068043 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmgl002.inf_amd64_neutral_e204d4267d752eb7 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmgl001.inf_amd64_neutral_9209e816461a1a73 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmgen.inf_amd64_neutral_7a967d06d569b1e4 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmgcs.inf_amd64_neutral_aafcd45e4e890862 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmgatew.inf_amd64_neutral_84eee4cc19fd00dc scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmfj2.inf_amd64_neutral_9c9eb67d406a1632 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmetech.inf_amd64_neutral_230358eeb58f0b3b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmeric2.inf_amd64_neutral_a0575ec9ce5c7de9 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmeric.inf_amd64_neutral_27c5b45728cc9ed0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmelsa.inf_amd64_neutral_374f9d31af832d6b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmeiger.inf_amd64_neutral_492d4e047d14bde9 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmdyna.inf_amd64_neutral_7e4d690d07ee94c1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmdsi.inf_amd64_neutral_e77f438012239042 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmdp2.inf_amd64_neutral_ab710894455d7b9a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmdgitn.inf_amd64_neutral_09132735f1063a47 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmdf56f.inf_amd64_neutral_26a79521b746fc31 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmdcm6.inf_amd64_neutral_b1db427ce3d2a1b4 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmdcm5.inf_amd64_neutral_0bb09f3e5a59f3a8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmcxpv6.inf_amd64_neutral_f62ac4bd04e653d0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmcxhv6.inf_amd64_neutral_81ba64c5b6150dd3 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmcrtix.inf_amd64_neutral_e91a5dc0655e200a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmcpv.inf_amd64_neutral_5667cca434e3a6b7 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmcpq2.inf_amd64_neutral_e9784021af1f5e24 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmcpq.inf_amd64_neutral_fbc4a14a6a13d0c8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmcomp.inf_amd64_neutral_e5ca2f01ca47bddb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmcommu.inf_amd64_neutral_83cc415156be45c8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmcom1.inf_amd64_neutral_96c22c683482d8bd scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmcodex.inf_amd64_neutral_9bb71004e7b8f7ae scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmcm28.inf_amd64_neutral_d3fa0f62d3d7cea1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmcdp.inf_amd64_neutral_170c11f3a6d3f0a8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmc26a.inf_amd64_neutral_547edd894d7c19d9 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmbw561.inf_amd64_neutral_fe42c0ff14d5562b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmbug3.inf_amd64_neutral_7617862a9cc286da scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmbtmdm.inf_amd64_neutral_2e4da8629fc5904e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmbsb.inf_amd64_neutral_56a9f6bceeec7f72 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmbr00a.inf_amd64_neutral_aa4f0850ff03674e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmbr008.inf_amd64_neutral_2cedaac353c381da scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmbr007.inf_amd64_neutral_91d259640bad7d26 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmbr006.inf_amd64_neutral_40c76453575b1208 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmbr005.inf_amd64_neutral_d140721f97061bba scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmbr004.inf_amd64_neutral_ccf1bc353e588fe1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmbr002.inf_amd64_neutral_ce2134188ab21f59 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmboca.inf_amd64_neutral_cc532ed7b3b5b5a9 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmaus.inf_amd64_neutral_5fa4270b9924b918 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmatm2k.inf_amd64_neutral_64a8fb018ead55a7 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmati.inf_amd64_neutral_ded8f26cdee953c3 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmarn.inf_amd64_neutral_fa693d8797766f49 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmarch.inf_amd64_neutral_4261401e3170ebfb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmar1.inf_amd64_neutral_b8ebf59556c3dbf0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmaiwat.inf_amd64_neutral_213e93b5ced8b0fe scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmaiwa5.inf_amd64_neutral_ea8128ac5da37eb9 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmaiwa4.inf_amd64_neutral_6e97842bb8d9e6a8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmaiwa3.inf_amd64_neutral_77e515342bd572cc scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmaiwa.inf_amd64_neutral_560c956da9bcd8f5 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmairte.inf_amd64_neutral_0feacd08cb9c7fe3 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmags64.inf_amd64_neutral_e68956e24e287714 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmagm64.inf_amd64_neutral_ef322a8cc2738a9b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdmadc.inf_amd64_neutral_62d6e6995428f9d0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdm5674a.inf_amd64_neutral_46f893a4f998bb46 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mdm3com.inf_amd64_neutral_11abcf129a29fb9f scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mcx2.inf_amd64_neutral_8cf9cade8f7bba56 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mchgr.inf_amd64_neutral_407146dba80d1566 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mbtmdm.inf_amd64_neutral_ad7a0b406dde284e\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\mbtmdm.inf_amd64_neutral_ad7a0b406dde284e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\machine.inf_amd64_neutral_a2f120466549d68b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\lsi_scsi.inf_amd64_neutral_cfbbf0b0b66ba280 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\lsi_sas2.inf_amd64_neutral_e12a5c4cfbe49204 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\lsi_sas.inf_amd64_neutral_a4d6780f72cbd5b4 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\lsi_fc.inf_amd64_neutral_a7088f3644ca646a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\lrcvbthk.inf_amd64_neutral_40fdbf8820c5245a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\lfunkraw.inf_amd64_neutral_5c58b8ea8dd7d4bf scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\lfmouhid.inf_amd64_neutral_15bf0b5561185425 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\lfkbdhid.inf_amd64_neutral_b43046e117a8fead scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\lfhidusb.inf_amd64_neutral_0a445d5f15c92fb6 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\lfhidhid.inf_amd64_neutral_8f0e1c5d59d9ffc0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\lfhideqd.inf_amd64_neutral_22634be1c1bbde36 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\lfeqdusb.inf_amd64_neutral_69618b691004862f scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\lcsrbthk.inf_amd64_neutral_ba7d3997a28622ab scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\lbtcoins.inf_amd64_neutral_22cfecf9a4eaaf51 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ksfilter.inf_amd64_neutral_86311fdf78a07678 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\kscaptur.inf_amd64_neutral_6cb3fb6811a3f83d scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ks.inf_amd64_neutral_2b583ce4a6a029a1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\keyboard.inf_amd64_neutral_0684fdc43059f486 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\itpcdless.inf_amd64_neutral_e3f3af39526e6f39 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\iscsi.inf_amd64_neutral_2ef24e9270d8b2a9 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ipmidrv.inf_amd64_neutral_1cb648411f252d13 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ipcdless.inf_amd64_neutral_9929569861bd473a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\input.inf_amd64_neutral_8693053514b10ee9 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\image.inf_amd64_neutral_4a983035eaabe2f4 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\iirsp2.inf_amd64_neutral_9ed65fe0bab06b1b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\iirsp.inf_amd64_neutral_25c14d33af7f54f1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\igdlh.inf_amd64_neutral_54a12b57f547d08e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\iastorv.inf_amd64_neutral_668286aa35d55928 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\iastorv.inf_amd64_neutral_0bcee2057afcc090 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hspusb.inf_amd64_neutral_aa9384c434d5a484\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hspusb.inf_amd64_neutral_aa9384c434d5a484 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hpsamd.inf_amd64_neutral_84ae149ecc9f8033 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hpoa1ss.inf_amd64_neutral_8cae09a2238d64e0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hpoa1so.inf_amd64_neutral_4f1a3f1015001339 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hpoa1sd.inf_amd64_neutral_caaa16c52c48f8ac scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hpoa1nd.inf_amd64_neutral_cf39c48277e038de scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hidserv.inf_amd64_neutral_f2223e39f37c69f3 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hidirkbd.inf_amd64_neutral_2b561a02e977e2e3 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hidir.inf_amd64_neutral_5b48c4b1b49ca54a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hiddigi.inf_amd64_neutral_12aaf5742a9969da scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hidbth.inf_amd64_neutral_8a1323fc68ad84af scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hdxrt.inf_amd64_neutral_7c6e33031050d748 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hdaudss.inf_amd64_neutral_330a593eb888237c scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hdaudio.inf_amd64_neutral_ce7bc199c85ae0a0 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hdaudbus.inf_amd64_neutral_4b99fffee061ff26 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hcw85c64.inf_amd64_neutral_96b71557b416d04a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hcw85b64.inf_amd64_neutral_22b436d5d06ab017 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hcw72b64.inf_amd64_neutral_023772237d3a4ade scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\hal.inf_amd64_neutral_232b95977cf6d84c scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\gameport.inf_amd64_neutral_fe5c4f29488f121e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\frmupgr.inf_amd64_neutral_b5d2e43c95cabb3d scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\flpydisk.inf_amd64_neutral_f54222cc59267e1e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\fdc.inf_amd64_neutral_bbcfca39fdc02275 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\faxcn002.inf_amd64_neutral_3d392ccc357e04db scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\faxcn001.inf_amd64_neutral_d23021a1eb548156 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\faxca003.inf_amd64_neutral_5b8c7c1dda79bef4 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\embda64.inf_amd64_neutral_98910a71c4757a64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\elxstor.inf_amd64_neutral_4263942b9dfe9077 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ehstorpwddrv.inf_amd64_neutral_ecd233d7cabbdebf scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\ehstorcertdrv.inf_amd64_neutral_2e1cecffae9c899a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\eaphost.inf_amd64_neutral_4506dea11740c089 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\dot4prt.inf_amd64_neutral_e7d3f62d0d4411db scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\dot4.inf_amd64_neutral_b89cfac15ccb2fba scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\divacx64.inf_amd64_neutral_fa0f82f024789743 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\display.inf_amd64_neutral_ea1c8215e52777a6 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\disk.inf_amd64_neutral_10ce25bbc5a9cc43 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\digitalmediadevice.inf_amd64_neutral_6fd673519d66ab20 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\dc3du.inf_amd64_neutral_682d0b0f5d3a65dd scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\dc3dh.inf_amd64_neutral_cf79b6829e7499ce scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\dc21x4vm.inf_amd64_neutral_8887242a56ee027e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\cxraptor_philipstuv1236d_ibv64.inf_amd64_neutral_b6a3e57df5bad299 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\cxraptor_fm1236mk5_ibv64.inf_amd64_neutral_b81bec917adfaea5 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\cxraptor_fm1216mk5_ibv64.inf_amd64_neutral_3eaae75b591bd148 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\cxfalpal_ibv64.inf_amd64_neutral_4c42ac5f00413365 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\cxfalcon_ibv64.inf_amd64_neutral_d065aec3fcf4ec4e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\crcdisk.inf_amd64_neutral_d10626d1f8b423c3 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\cpu.inf_amd64_neutral_ae5de2e1bf2793c3 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\compositebus.inf_amd64_neutral_b9280780a8000d4b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\circlass.inf_amd64_neutral_cf52485bed804e02 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\cf64win7.inf_amd64_neutral_df404016710683cb scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\cdrom.inf_amd64_neutral_0b3d0d1942ab684b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\c7xxphone.inf_amd64_neutral_4732a16017f7bb26\XP64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\c7xxphone.inf_amd64_neutral_4732a16017f7bb26\W764 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\c7xxphone.inf_amd64_neutral_4732a16017f7bb26\VT64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\c7xxphone.inf_amd64_neutral_4732a16017f7bb26 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\c2scsi.inf_amd64_neutral_cb54318754bef3b4\WinNT\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\c2scsi.inf_amd64_neutral_cb54318754bef3b4\WinNT scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\c2scsi.inf_amd64_neutral_cb54318754bef3b4 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\bthspp.inf_amd64_neutral_1b15060bdfbd09e1 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\bthprint.inf_amd64_neutral_3c11362fa327f5a4 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\bthpan.inf_amd64_neutral_024281c0e4e954e2 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\bthmtpenum.inf_amd64_neutral_c70e85b87ee4ece9 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\bth.inf_amd64_neutral_e54666f6a3e5af91 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\bth.inf_amd64_neutral_ca26c6da62d71ca8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\brpri082.inf_amd64_neutral_0fc720db5fd03df2 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\brpoi082.inf_amd64_neutral_6bceb708b26c634b scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\brmfport.inf_amd64_neutral_f41f35e5c21bc350 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\brmfcwia.inf_amd64_neutral_817b8835aed3d6b7 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\brmfcumd.inf_amd64_neutral_db43b26810939b3e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\brmfcsto.inf_amd64_neutral_2d7208355536945e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\brmfcmf.inf_amd64_neutral_67b5984f8e8ff717 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\brmfcmdm.inf_amd64_neutral_af49d2f3ffa12116 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\brimi082.inf_amd64_neutral_2d5de3655a75bbcc\amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\brimi082.inf_amd64_neutral_2d5de3655a75bbcc scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\blbdrive.inf_amd64_neutral_1aa816fe7dc98c3f scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\bda.inf_amd64_neutral_41c6262952846788 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\bcbtums-win7x64-brcm.inf_amd64_neutral_f8b5fe3d8da73726 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\bcbtums-vistax64-brcm.inf_amd64_neutral_1f8ed769b35bd460 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\bcbthid64.inf_amd64_neutral_8e8c2fc32f8b37fe scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\battery.inf_amd64_neutral_cb8fa151a7b7cb80 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\avmx64c.inf_amd64_neutral_8ebb15bf548db022 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\averhbh826_noaverir_x64.inf_amd64_neutral_2fe3b14136d6e46d scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\averfx2swtv_x64.inf_amd64_neutral_24a71cdaabc7f783 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\averfx2swtv_noavin_x64.inf_amd64_neutral_86943dd17860e449 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\averfx2hbtv_x64.inf_amd64_neutral_7216b6fb23536c40 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\averfx2hbh826d_noaverir_x64.inf_amd64_neutral_da2ba9e8a30dad14 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\avc.inf_amd64_neutral_3ef33c750e6308ce scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\atiriol6.inf_amd64_neutral_bde34ad5722cca75 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\atiilhag.inf_amd64_neutral_0a660e899f5038a2 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\arcsas.inf_amd64_neutral_c763887719bed95d scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\arc.inf_amd64_neutral_11b52dec8e94d9aa scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\angelu64.inf_amd64_neutral_3d6079dd78127f5e scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\angel64.inf_amd64_neutral_6bed16c93db1ccf3 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\angel264.inf_amd64_neutral_04b54b6322607cce scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\amdsbs.inf_amd64_neutral_5cae6933bef20aa8 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\amdsata.inf_amd64_neutral_67db50590108ebd9 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\amdsata.inf_amd64_neutral_5c3d0d1e97e99e10 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\agp.inf_amd64_neutral_22cdceb61fbafb43 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\af9035bda.inf_amd64_neutral_aa11aa34552d1d4d scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\adpu320.inf_amd64_neutral_4ea3d42a9839982a scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\adpahci.inf_amd64_neutral_b082e95ec9f8c3f9 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\adp94xx.inf_amd64_neutral_4928c8870f6a1577 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\adobepdf.inf_amd64_neutral_70cb20a3417216e2\Amd64Vista scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\adobepdf.inf_amd64_neutral_70cb20a3417216e2\Amd64 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\adobepdf.inf_amd64_neutral_70cb20a3417216e2 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\acpipmi.inf_amd64_neutral_256ad642985694b3 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\acpi.inf_amd64_neutral_aed2e7a487803437 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\61883.inf_amd64_neutral_a64d66bac757464c scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository\1394.inf_amd64_neutral_0b11366838152a76 scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\FileRepository scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore\en-US scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\DriverStore scheduled to be moved on reboot.

C:\Windows\system64\drivers\UMDF\en-US folder moved successfully.

Folder move failed. C:\Windows\system64\drivers\UMDF scheduled to be moved on reboot.

C:\Windows\system64\drivers\etc folder moved successfully.

C:\Windows\system64\drivers\en-US folder moved successfully.

Folder move failed. C:\Windows\system64\drivers scheduled to be moved on reboot.

C:\Windows\system64\Dism\en-US folder moved successfully.

Folder move failed. C:\Windows\system64\Dism scheduled to be moved on reboot.

C:\Windows\system64\de-DE folder moved successfully.

C:\Windows\system64\da-DK folder moved successfully.

C:\Windows\system64\cs-CZ folder moved successfully.

Folder move failed. C:\Windows\system64\config\TxR scheduled to be moved on reboot.

C:\Windows\system64\config\systemprofile\Videos folder moved successfully.

C:\Windows\system64\config\systemprofile\Pictures folder moved successfully.

C:\Windows\system64\config\systemprofile\Music folder moved successfully.

C:\Windows\system64\config\systemprofile\Favorites\Links folder moved successfully.

C:\Windows\system64\config\systemprofile\Favorites folder moved successfully.

C:\Windows\system64\config\systemprofile\Downloads folder moved successfully.

C:\Windows\system64\config\systemprofile\Documents folder moved successfully.

C:\Windows\system64\config\systemprofile\Desktop folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\Themes folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\Startup folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\Administrative Tools folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\Accessories\System Tools folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\Accessories folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\Start Menu\Programs folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\Start Menu folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\SendTo folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\Recent\CustomDestinations folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\Recent\AutomaticDestinations folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\Recent folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\PrivacIE\Low folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\PrivacIE folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\Libraries folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\IETldCache\Low folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\IETldCache folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\IECompatCache\Low folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\IECompatCache folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\Cookies\Low folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows\Cookies folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Windows folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Vault folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\SystemCertificates\My\CTLs folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\SystemCertificates\My\CRLs folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\SystemCertificates\My\Certificates folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\SystemCertificates\My folder moved successfully.

Folder move failed. C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\SystemCertificates scheduled to be moved on reboot.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Speech\Files\UserLexicons folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Speech\Files folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Speech folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Microsoft IntelliType Pro\SQM folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Microsoft IntelliType Pro folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Media Player folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Internet Explorer\UserData\Low folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Internet Explorer\UserData folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Internet Explorer\Quick Launch\User Pinned\TaskBar folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Internet Explorer\Quick Launch\User Pinned\ImplicitAppShortcuts folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Internet Explorer\Quick Launch\User Pinned folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Internet Explorer\Quick Launch folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\Internet Explorer folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\IdentityCRL\production\temp folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\IdentityCRL\production folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft\IdentityCRL folder moved successfully.

Folder move failed. C:\Windows\system64\config\systemprofile\AppData\Roaming\Microsoft scheduled to be moved on reboot.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Logitech\SetPoint folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Roaming\Logitech folder moved successfully.

Folder move failed. C:\Windows\system64\config\systemprofile\AppData\Roaming scheduled to be moved on reboot.

C:\Windows\system64\config\systemprofile\AppData\LocalLow\Sun\Java\Deployment folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\LocalLow\Sun\Java folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\LocalLow\Sun folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\LocalLow\Microsoft\CryptnetUrlCache\MetaData folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\LocalLow\Microsoft\CryptnetUrlCache\Content folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\LocalLow\Microsoft\CryptnetUrlCache folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\LocalLow\Microsoft folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\LocalLow folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Temp folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Windows Mail\Backup folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Windows Mail folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Windows\Themes folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Windows\Temporary Internet Files folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Windows\Ringtones folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Windows\History\Low folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Windows\History\History.IE5 folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Windows\History folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Windows\Explorer folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Windows\Caches folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Windows\Burn\Burn3 folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Windows\Burn\Burn2 folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Windows\Burn\Burn1 folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Windows\Burn\Burn folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Windows\Burn folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Windows folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Vault\4BF4C442-9B8A-41A0-B380-DD4A704DDB28 folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Vault folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Portable Devices folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Media Player folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Internet Explorer folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\IdentityCRL\production\temp folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\IdentityCRL\production folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\IdentityCRL folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Feeds Cache\MI2AD1KI folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Feeds Cache\KH3E5EL2 folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Feeds Cache\E2PZIOK3 folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Feeds Cache\7YH2VH13 folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Feeds Cache folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Feeds\{5588ACFD-6436-411B-A5CE-666AE6A92D3D}~\WebSlices~ folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Feeds\{5588ACFD-6436-411B-A5CE-666AE6A92D3D}~ folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft\Feeds folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local\Microsoft folder moved successfully.

C:\Windows\system64\config\systemprofile\AppData\Local folder moved successfully.

Folder move failed. C:\Windows\system64\config\systemprofile\AppData scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\config\systemprofile scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\config\RegBack scheduled to be moved on reboot.

C:\Windows\system64\config\Journal folder moved successfully.

Folder move failed. C:\Windows\system64\config scheduled to be moved on reboot.

C:\Windows\system64\com\en-US folder moved successfully.

C:\Windows\system64\com\dmp folder moved successfully.

Folder move failed. C:\Windows\system64\com scheduled to be moved on reboot.

C:\Windows\system64\CodeIntegrity folder moved successfully.

Folder move failed. C:\Windows\system64\catroot2\{F750E6C3-38EE-11D1-85E5-00C04FC295EE} scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\catroot2\{127D0A1D-4EF2-11D1-8608-00C04FC295EE} scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\catroot2 scheduled to be moved on reboot.

C:\Windows\system64\catroot\{F750E6C3-38EE-11D1-85E5-00C04FC295EE} folder moved successfully.

C:\Windows\system64\catroot\{127D0A1D-4EF2-11D1-8608-00C04FC295EE} folder moved successfully.

C:\Windows\system64\catroot folder moved successfully.

Folder move failed. C:\Windows\system64\Boot\en-US scheduled to be moved on reboot.

Folder move failed. C:\Windows\system64\Boot scheduled to be moved on reboot.

C:\Windows\system64\bg-BG folder moved successfully.

C:\Windows\system64\ar-SA folder moved successfully.

C:\Windows\system64\appmgmt\S-1-5-21-786879198-253778329-1393635891-1000 folder moved successfully.

C:\Windows\system64\appmgmt\S-1-5-18 folder moved successfully.

C:\Windows\system64\appmgmt\MACHINE folder moved successfully.

C:\Windows\system64\appmgmt folder moved successfully.

Folder move failed. C:\Windows\system64\AdvancedInstallers scheduled to be moved on reboot.

C:\Windows\system64\0409 folder moved successfully.

C:\Windows\system64 folder moved successfully.

========== COMMANDS ==========


User: All Users

User: Default

->Temp folder emptied: 0 bytes

->Temporary Internet Files folder emptied: 0 bytes

->Flash cache emptied: 0 bytes

User: Default User

->Temp folder emptied: 0 bytes

->Temporary Internet Files folder emptied: 0 bytes

->Flash cache emptied: 0 bytes

User: Michal

->Temp folder emptied: 108788 bytes

->Temporary Internet Files folder emptied: 393928 bytes

->Java cache emptied: 0 bytes

->FireFox cache emptied: 279684541 bytes

->Flash cache emptied: 1509 bytes

User: Public

User: UpdatusUser

->Temp folder emptied: 0 bytes

->Temporary Internet Files folder emptied: 0 bytes

User: Widomski

->Temp folder emptied: 134 bytes

->Temporary Internet Files folder emptied: 2850816 bytes

->Java cache emptied: 0 bytes

->FireFox cache emptied: 0 bytes

->Flash cache emptied: 652 bytes

%systemdrive% .tmp files removed: 0 bytes

%systemroot% .tmp files removed: 0 bytes

%systemroot%\System32 .tmp files removed: 0 bytes

%systemroot%\System32 (64bit) .tmp files removed: 0 bytes

%systemroot%\System32\drivers .tmp files removed: 0 bytes

Windows Temp folder emptied: 0 bytes

RecycleBin emptied: 0 bytes

Total Files Cleaned = 270.00 mb

Restore point Set: OTL Restore Point

OTL by OldTimer - Version log created on 04292012_001930
  • 0




  • Topic Starter
  • Member
  • PipPipPip
  • 343 posts
System Restore didn't work either.
  • 0



    Anti-Malware Mammoth

  • Expert
  • 9,717 posts
Hi. :)

Most unfortunate and that should not have occurred. You should have really informed myself straight away rather than attempting any self fixes. Remember I did mention about such in my first reply to your good-self...

Though I am wondering why so much was in the actual system64 folder. As that should not exist on a Windows 7 64 bit machine at all. Unless created by malware and anything that requires to be ran as say the 32 bit architecture would be in the SysWow64 folder as a rule. Though feasible such was created legitimately during the original W7 64 bit installation if both drives were connected rather than just one but never encountered such being honest.

However I suspect the root cause and the explanation of the folder in question is all due to the severe malware infection(s). Anyway a pity you have now lost the contents of the OTL moved folder from the last custom script. Not to worry and lets see what can be done to rectify the situation as follows...


Disconnect Drive D, you may reconnect again afterwards if the below is successful. Then undo the System Restore you mentioned...

Now place your Windows 7 Start-Up Repair disk in the optical drive, then reboot your machine. During the POST(Power On Self Test) sequence continually depress Function Key 8(F8) to bring up the Advanced Boot Options screen.

Use the arrow keys to scroll down and select Safe Mode and hit the Enter/Return key.


In Safe Mode carry out the following:-

Right-click on Start(Windows 7 Orb) >> Open Windows Explorer >> Local Disk (C:) >> Windows >> ERDNT

Double-click on the folder DD-DD-YYYY <-- denotes date/year etc to expand >> right-click on ERDNT.exe and select Run as Administrator >> follow the prompts.

When your machine starts to reboot actually boot it up from the Windows 7 Start-Up Repair disk this time...

  • You will have to answer a few basic questions then select the option Repair your computer
  • At the the System Recovery Options screen click Windows 7 to highlight then Next>
  • Now click on/select Startup Repair
  • If prompted to use System Restore, select Cancel.
  • The same if prompted to Send information about this problem (recommended), select Don't send.
  • Click Finish when Startup Repair has completed, remove the SRD disc and then click on Restart

Providing your machine is now able to boot into Normal Mode correctly, carry out the following...

  • Click on Start(Windows 7 Orb).
  • Click on All Programs >> Accessories
  • Right click on Command Prompt and select Run as Administrator.
  • Click on Continue in the UAC prompt.
  • At the Command Prompt C:\Windows\System32> type in the following exactly:
  • CD C:\
  • Then depress the Enter/Return key, then type in the following exactly:
  • sfc /scannow
  • Then depress the Enter/Return key.
Note: This may take awhile to finish. When completed close the Administrator Command Prompt window, via typing Exit then depress the Enter/Return key.


Let myself know the outcome of the above when completed(if the need we will merely try something else) and we will go from there, thank you.
  • 0




  • Topic Starter
  • Member
  • PipPipPip
  • 343 posts
Sorry, maybe I should have been a bit clearer. The system restore failed, and the moved files still exist. Does that change the situation?
  • 0



    Anti-Malware Mammoth

  • Expert
  • 9,717 posts
OK, no problem. Let myself have a think about this and I will get back to you shortly. :)
  • 0

Similar Topics

0 user(s) are reading this topic

0 members, 0 guests, 0 anonymous users

As Featured On:

Microsoft Yahoo BBC MSN PC Magazine Washington Post HP